STX1A

Functionⁱ

Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca²⁺-regulation of exocytosis acrosomal reaction in sperm.By similarity

GO - Molecular functionⁱ

ATP-dependent protein binding Source: Ensembl
calcium channel inhibitor activity Source: Ensembl
calcium-dependent protein binding Source: Ensembl
chloride channel inhibitor activity
Source: UniProtKB
Inferred from direct assayⁱ
- 18570918
ion channel binding Source: Ensembl
kinase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 12730201
myosin binding Source: GO_Central
myosin head/neck binding Source: Ensembl
protein binding, bridging Source: Ensembl
protein domain specific binding Source: Ensembl
protein heterodimerization activity Source: Ensembl
protein N-terminus binding Source: Ensembl
SNAP receptor activity Source: GO_Central
SNARE binding Source: GO_Central

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cytokine-mediated signaling pathway Source: Reactome
intracellular protein transport Source: GO_Central
positive regulation of calcium ion-dependent exocytosis Source: UniProtKB
positive regulation of catecholamine secretion Source: UniProtKB
positive regulation of excitatory postsynaptic potential Source: Ensembl
positive regulation of neurotransmitter secretion Source: Ensembl
positive regulation of norepinephrine secretion Source: UniProtKB
protein localization to membrane Source: Ensembl
regulation of insulin secretion
Source: UniProtKB
Traceable author statementⁱ
- 15537656
regulation of synaptic vesicle priming Source: Ensembl
response to gravity Source: Ensembl
secretion by cell
Source: UniProtKB
Inferred from direct assayⁱ
- 12130530
SNARE complex assembly Source: Ensembl
synaptic vesicle docking Source: Ensembl
synaptic vesicle fusion to presynaptic active zone membrane Source: GO_Central
vesicle docking Source: GO_Central

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Exocytosis, Neurotransmitter transport, Transport

Biological process

Exocytosis, Neurotransmitter transport, Transport

Enzyme and pathway databases

Reactomeⁱ	R-HSA-181429 Serotonin Neurotransmitter Release Cycle R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle R-HSA-210500 Glutamate Neurotransmitter Release Cycle R-HSA-212676 Dopamine Neurotransmitter Release Cycle R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle R-HSA-264876 Insulin processing R-HSA-422356 Regulation of insulin secretion R-HSA-449836 Other interleukin signaling R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C) R-HSA-5682910 LGI-ADAM interactions R-HSA-6794361 Neurexins and neuroligins R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORⁱ	Q16623

Reactomeⁱ

R-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation

SIGNORⁱ

Q16623

Protein family/group databases

TCDBⁱ	1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family 8.A.91.1.4 the syntaxin (syntaxin) family

TCDBⁱ

1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Syntaxin-1A Alternative name(s): Neuron-specific antigen HPC-1
Gene namesⁱ	Name:STX1A Synonyms:STX1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 7

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000106089.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11433 STX1A
MIMⁱ	186590 gene
neXtProtⁱ	NX_Q16623

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 265	CytoplasmicSequence analysisAdd BLAST	265
Transmembraneⁱ	266 – 286	Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	287 – 288	ExtracellularSequence analysis	2

Keywords - Cellular componentⁱ

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

Pathology & Biotechⁱ

Involvement in diseaseⁱ

STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.1 Publication

Keywords - Diseaseⁱ

Williams-Beuren syndrome

Organism-specific databases

DisGeNET More...DisGeNETⁱ	6804
MalaCards human disease database More...MalaCardsⁱ	STX1A
Open Targets More...OpenTargetsⁱ	ENSG00000106089
Orphanetⁱ	586 Cystic fibrosis
PharmGKBⁱ	PA36233

Polymorphism and mutation databases

BioMutaⁱ	STX1A
DMDMⁱ	2501084

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000210186	1 – 288	Syntaxin-1AAdd BLAST		288

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	14	PhosphoserineCombined sources	1
Modified residueⁱ	64	PhosphoserineBy similarity	1
Modified residueⁱ	95	PhosphoserineBy similarity	1
Modified residueⁱ	188	Phosphoserine; by DAPK11 Publication	1

Post-translational modificationⁱ

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.By similarity1 Publication

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

PaxDbⁱ	Q16623
PeptideAtlas More...PeptideAtlasⁱ	Q16623
PRIDEⁱ	Q16623
ProteomicsDBⁱ	60963 60964 [Q16623-2] 60965 [Q16623-3]

PTM databases

iPTMnetⁱ	Q16623
PhosphoSitePlusⁱ	Q16623

Expressionⁱ

Tissue specificityⁱ

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_STX1A
ExpressionAtlasⁱ	Q16623 baseline and differential
Genevisibleⁱ	Q16623 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB008372 HPA069176

HPAⁱ

CAB008372
HPA069176

Interactionⁱ

Subunit structureⁱ

Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity). Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A (By similarity). This complex binds to CPLX1 (By similarity). Binds SYTL4 and STXBP6 (By similarity). Found in a ternary complex with STX1A and SNAP25 (By similarity). Interacts with PLCL1 (via C2 domain) (By similarity). Interacts with OTOF and LGI3 (By similarity). Interacts with SLC6A4 (By similarity). Interacts with SYT6 and SYT8; the interaction is Ca²⁺-dependent (By similarity). Found in a complex with VAMP8 and SNAP23 (PubMed:12130530). Interacts with VAPA and SYBU (PubMed:15459722). Interacts with STXBP1 and DAPK1 (PubMed:12730201). Interacts with PRRT2 (By similarity).By similarity3 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
GOSR2	O14653	4	EBI-712466,EBI-4401517
NAPB	Q9H115	4	EBI-712466,EBI-3921185
SNAP29	O95721	3	EBI-712466,EBI-490676
STX4	Q12846	4	EBI-712466,EBI-744942

GO - Molecular functionⁱ

ATP-dependent protein binding Source: Ensembl
calcium-dependent protein binding Source: Ensembl
ion channel binding Source: Ensembl
kinase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 12730201
myosin binding Source: GO_Central
myosin head/neck binding Source: Ensembl
protein binding, bridging Source: Ensembl
protein domain specific binding Source: Ensembl
protein heterodimerization activity Source: Ensembl
protein N-terminus binding Source: Ensembl
SNAP receptor activity Source: GO_Central
SNARE binding Source: GO_Central

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	112676, 56 interactors
CORUMⁱ	Q16623
Database of interacting proteins More...DIPⁱ	DIP-390N
IntActⁱ	Q16623, 121 interactors
STRINGⁱ	9606.ENSP00000222812

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q16623
SMRⁱ	Q16623
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	192 – 254	t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST		63

Coiled coil

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Coiled coilⁱ	68 – 109	Sequence analysisAdd BLAST		42

Sequence similaritiesⁱ

Belongs to the syntaxin family.Curated

Keywords - Domainⁱ

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG0810 Eukaryota COG5074 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000119200
HOGENOMⁱ	HOG000286023
HOVERGENⁱ	HBG000497
InParanoidⁱ	Q16623
KEGG Orthology (KO) More...KOⁱ	K04560
OMAⁱ	MGQEQSF
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0EUK
PhylomeDBⁱ	Q16623
TreeFamⁱ	TF313763

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00179 SynN, 1 hit
InterProⁱ	View protein in InterPro IPR010989 SNARE IPR028669 STX1A IPR006012 Syntaxin/epimorphin_CS IPR006011 Syntaxin_N IPR000727 T_SNARE_dom
PANTHERⁱ	PTHR19957:SF84 PTHR19957:SF84, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF05739 SNARE, 1 hit PF00804 Syntaxin, 1 hit
SMARTⁱ	View protein in SMART SM00503 SynN, 1 hit SM00397 t_SNARE, 1 hit
SUPFAMⁱ	SSF47661 SSF47661, 1 hit
PROSITEⁱ	View protein in PROSITE PS00914 SYNTAXIN, 1 hit PS50192 T_SNARE, 1 hit

Sequences (3+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 3 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: Q16623-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN 
        60         70         80         90        100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 
       110        120        130        140        150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 
       160        170        180        190        200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 
       210        220        230        240        250
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD 
       260        270        280 
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA

Length:288

Mass (Da):33,023

Last modified:November 1, 1996 - v1

Checksum:ⁱ8AC787EFCE65ACA1

GO

Isoform 2 (identifier: Q16623-2) [UniParc]FASTA Add to basket

Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

« Hide

        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN 
        60         70         80         90        100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 
       110        120        130        140        150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 
       160        170        180        190        200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 
       210        220        230        240        250
EIIKLENSIR ELHDMFMDMA MLVESQPQGA FLKSCPEPQP NREEGALWSS 
       260
GAPGPAGRDD

Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.

Show »

Length:260

Mass (Da):29,632

Checksum:ⁱ546C1582FE83499E

GO

Isoform 3 (identifier: Q16623-3) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

« Hide

        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN 
        60         70         80         90        100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 
       110        120        130        140        150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 
       160        170        180        190        200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 
       210        220        230        240        250
EIIKLENSIR ELHDMFMDMA MLVESQTMWR GPCLTPRRPS STRARRAGRK 

S

Show »

Length:251

Mass (Da):28,995

Checksum:ⁱC885D46384137E0B

GO

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A8MZ54	A8MZ54_HUMAN	Syntaxin-1A Syntaxin-1A	STX1A	280	Annotation score:
A0A0C4DFZ1	A0A0C4DFZ1_HUMAN	Syntaxin-1A Syntaxin-1A	STX1A	260	Annotation score:

Sequence cautionⁱ

The sequence AAA20940 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	73	E → V in AAA20940 (Ref. 10) Curated		1
Sequence conflictⁱ	140	D → V in AAA20940 (Ref. 10) Curated		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_006338	227 – 288	GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsAdd BLAST		62
Alternative sequenceⁱVSP_006339	227 – 288	GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationAdd BLAST		62

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L37792 mRNA Translation: AAA53519.1 U87315 U87314 Genomic DNA Translation: AAK54507.2 U87315 U87314 Genomic DNA Translation: AAB65500.2 D37932 mRNA Translation: BAA07151.1 AB086954 mRNA Translation: BAC78519.1 AC073846 Genomic DNA Translation: AAS07470.1 CH471200 Genomic DNA Translation: EAW69650.1 BC000444 mRNA No translation available. BC003011 mRNA Translation: AAH03011.1 BC064644 mRNA Translation: AAH64644.1 U12918 mRNA Translation: AAA20940.1 Different initiation.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS34655.1 [Q16623-1] CCDS55120.1 [Q16623-3]
NCBI Reference Sequences More...RefSeqⁱ	NP_001159375.1, NM_001165903.1 [Q16623-3] NP_004594.1, NM_004603.3 [Q16623-1]
UniGeneⁱ	Hs.647024

Genome annotation databases

Ensemblⁱ	ENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1] ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]
GeneIDⁱ	6804
KEGGⁱ	hsa:6804
UCSC genome browser More...UCSCⁱ	uc003tyy.4 human [Q16623-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q16623	Uncharacterized protein		PANTR		344	UniRef100_Q16623
Syntaxin-1A isoform 1 (Fragment)		MACMU		260
STX1A protein		HUMAN		288
Syntaxin 1A		CALJA		288
STX1A isoform 3		PONAB		288
+2
Q16623-3	STX1A isoform 2		PANTR		251	UniRef100_A0A2J8Q8I5

Protein	Similar proteins		Species	Score	Length	Source
Q16623	Uncharacterized protein		PANTR		344	UniRef90_Q16623
Syntaxin-1A isoform 1 (Fragment)		MACMU		260
STX1A protein		HUMAN		288
Syntaxin 1A		CALJA		288
STX1A isoform 3		PONAB		288
+3
Q16623-2	Syntaxin-1A		HUMAN		260	UniRef90_Q16623-2
STX1A isoform 5		PONAB		260
STX1A isoform 5		PANTR		260
Uncharacterized protein		RHIRO		229
UPI000C9F7EF4		OCTDE		273
+1
Q16623-3	Syntaxin-1A		MOUSE		256	UniRef90_D6RFB9
Uncharacterized protein		PROCO		261
Uncharacterized protein		FELCA		252
STX1A isoform 2		PANTR		251
STX1A isoform 2		PONAB		251
+9

Protein	Similar proteins		Species	Score	Length	Source
Q16623	Syntaxin-1B		BOVIN		288	UniRef50_Q16623
Syntaxin-1B		SHEEP		288
Uncharacterized protein		PANTR		344
Syntaxin-1A isoform 1 (Fragment)		MACMU		260
STX1A protein		HUMAN		288
+479
Q16623-2	Syntaxin-1A		HUMAN		260	UniRef50_Q16623-2
STX1A isoform 5		PONAB		260
STX1A isoform 5		PANTR		260
Uncharacterized protein		RHIRO		229
Syntaxin 1A		LOXAF		282
+65
Q16623-3	Isoform 2 of Syntaxin-1A		HUMAN		260	UniRef50_Q16623-2
STX1A isoform 5		PONAB		260
STX1A isoform 5		PANTR		260
Uncharacterized protein		RHIRO		229
Syntaxin 1A		LOXAF		282
+65

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L37792 mRNA Translation: AAA53519.1 U87315 U87314 Genomic DNA Translation: AAK54507.2 U87315 U87314 Genomic DNA Translation: AAB65500.2 D37932 mRNA Translation: BAA07151.1 AB086954 mRNA Translation: BAC78519.1 AC073846 Genomic DNA Translation: AAS07470.1 CH471200 Genomic DNA Translation: EAW69650.1 BC000444 mRNA No translation available. BC003011 mRNA Translation: AAH03011.1 BC064644 mRNA Translation: AAH64644.1 U12918 mRNA Translation: AAA20940.1 Different initiation.
CCDSⁱ	CCDS34655.1 [Q16623-1] CCDS55120.1 [Q16623-3]
RefSeqⁱ	NP_001159375.1, NM_001165903.1 [Q16623-3] NP_004594.1, NM_004603.3 [Q16623-1]
UniGeneⁱ	Hs.647024

3D structure databases

ProteinModelPortalⁱ	Q16623
SMRⁱ	Q16623
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112676, 56 interactors
CORUMⁱ	Q16623
DIPⁱ	DIP-390N
IntActⁱ	Q16623, 121 interactors
STRINGⁱ	9606.ENSP00000222812

Protein family/group databases

TCDBⁱ	1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family 8.A.91.1.4 the syntaxin (syntaxin) family

TCDBⁱ

1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

PTM databases

iPTMnetⁱ	Q16623
PhosphoSitePlusⁱ	Q16623

Polymorphism and mutation databases

BioMutaⁱ	STX1A
DMDMⁱ	2501084

Proteomic databases

PaxDbⁱ	Q16623
PeptideAtlasⁱ	Q16623
PRIDEⁱ	Q16623
ProteomicsDBⁱ	60963 60964 [Q16623-2] 60965 [Q16623-3]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	6804
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1] ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]
GeneIDⁱ	6804
KEGGⁱ	hsa:6804
UCSCⁱ	uc003tyy.4 human [Q16623-1]

Organism-specific databases

CTDⁱ	6804
DisGeNETⁱ	6804
EuPathDBⁱ	HostDB:ENSG00000106089.11
GeneCardsⁱ	STX1A
HGNCⁱ	HGNC:11433 STX1A
HPAⁱ	CAB008372 HPA069176
MalaCardsⁱ	STX1A
MIMⁱ	186590 gene
neXtProtⁱ	NX_Q16623
OpenTargetsⁱ	ENSG00000106089
Orphanetⁱ	586 Cystic fibrosis
PharmGKBⁱ	PA36233
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0810 Eukaryota COG5074 LUCA
GeneTreeⁱ	ENSGT00760000119200
HOGENOMⁱ	HOG000286023
HOVERGENⁱ	HBG000497
InParanoidⁱ	Q16623
KOⁱ	K04560
OMAⁱ	MGQEQSF
OrthoDBⁱ	EOG091G0EUK
PhylomeDBⁱ	Q16623
TreeFamⁱ	TF313763

Enzyme and pathway databases

Reactomeⁱ	R-HSA-181429 Serotonin Neurotransmitter Release Cycle R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle R-HSA-210500 Glutamate Neurotransmitter Release Cycle R-HSA-212676 Dopamine Neurotransmitter Release Cycle R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle R-HSA-264876 Insulin processing R-HSA-422356 Regulation of insulin secretion R-HSA-449836 Other interleukin signaling R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C) R-HSA-5682910 LGI-ADAM interactions R-HSA-6794361 Neurexins and neuroligins R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORⁱ	Q16623

Reactomeⁱ

R-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation

SIGNORⁱ

Q16623

Miscellaneous databases

GeneWikiⁱ	STX1A
GenomeRNAiⁱ	6804
Protein Ontology More...PROⁱ	PR:Q16623
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_STX1A
ExpressionAtlasⁱ	Q16623 baseline and differential
Genevisibleⁱ	Q16623 HS

Family and domain databases

CDDⁱ	cd00179 SynN, 1 hit
InterProⁱ	View protein in InterPro IPR010989 SNARE IPR028669 STX1A IPR006012 Syntaxin/epimorphin_CS IPR006011 Syntaxin_N IPR000727 T_SNARE_dom
PANTHERⁱ	PTHR19957:SF84 PTHR19957:SF84, 1 hit
Pfamⁱ	View protein in Pfam PF05739 SNARE, 1 hit PF00804 Syntaxin, 1 hit
SMARTⁱ	View protein in SMART SM00503 SynN, 1 hit SM00397 t_SNARE, 1 hit
SUPFAMⁱ	SSF47661 SSF47661, 1 hit
PROSITEⁱ	View protein in PROSITE PS00914 SYNTAXIN, 1 hit PS50192 T_SNARE, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	STX1A_HUMAN
Accessionⁱ	Q16623Primary (citable) accession number: Q16623 Secondary accession number(s): O15447 , O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	November 1, 1996
	Last modified:	October 10, 2018
	This is version 187 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 7
Human chromosome 7: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q16623 (STX1A_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Syntaxin-1A

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Other locations

Extracellular region or secreted

Cytoskeleton

Cytosol

Extracellular region or secreted

Nucleus

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Coiled coil

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ