UniProtKB - Q16623 (STX1A_HUMAN)
Syntaxin-1A
STX1A
Functioni
GO - Molecular functioni
- ATP-dependent protein binding Source: Ensembl
- calcium channel inhibitor activity Source: Ensembl
- calcium-dependent protein binding Source: Ensembl
- chloride channel inhibitor activity Source: UniProtKB
- identical protein binding Source: IntAct
- ion channel binding Source: Ensembl
- kinase binding Source: UniProtKB
- myosin head/neck binding Source: Ensembl
- protein-containing complex binding Source: Ensembl
- protein domain specific binding Source: Ensembl
- protein N-terminus binding Source: Ensembl
- SNAP receptor activity Source: GO_Central
- SNARE binding Source: GO_Central
GO - Biological processi
- calcium-ion regulated exocytosis Source: Ensembl
- cytokine-mediated signaling pathway Source: Reactome
- exocytosis Source: GO_Central
- glutamate secretion Source: Reactome
- insulin secretion Source: Ensembl
- intracellular protein transport Source: GO_Central
- neurotransmitter secretion Source: Reactome
- positive regulation of calcium ion-dependent exocytosis Source: UniProtKB
- positive regulation of catecholamine secretion Source: UniProtKB
- positive regulation of excitatory postsynaptic potential Source: Ensembl
- positive regulation of neurotransmitter secretion Source: Ensembl
- positive regulation of norepinephrine secretion Source: UniProtKB
- protein localization to membrane Source: Ensembl
- protein sumoylation Source: UniProtKB
- regulation of insulin secretion Source: UniProtKB
- regulation of synaptic vesicle priming Source: Ensembl
- response to gravity Source: Ensembl
- secretion by cell Source: UniProtKB
- SNARE complex assembly Source: Ensembl
- synaptic vesicle docking Source: Ensembl
- synaptic vesicle endocytosis Source: UniProtKB
- synaptic vesicle exocytosis Source: UniProtKB
- synaptic vesicle fusion to presynaptic active zone membrane Source: GO_Central
- vesicle docking Source: GO_Central
- vesicle fusion Source: GO_Central
Keywordsi
Biological process | Exocytosis, Neurotransmitter transport, Transport |
Enzyme and pathway databases
PathwayCommonsi | Q16623 |
Reactomei | R-HSA-181429, Serotonin Neurotransmitter Release Cycle R-HSA-181430, Norepinephrine Neurotransmitter Release Cycle R-HSA-210500, Glutamate Neurotransmitter Release Cycle R-HSA-212676, Dopamine Neurotransmitter Release Cycle R-HSA-264642, Acetylcholine Neurotransmitter Release Cycle R-HSA-264876, Insulin processing R-HSA-422356, Regulation of insulin secretion R-HSA-449836, Other interleukin signaling R-HSA-5250971, Toxicity of botulinum toxin type C (BoNT/C) R-HSA-5682910, LGI-ADAM interactions R-HSA-6794361, Neurexins and neuroligins R-HSA-888590, GABA synthesis, release, reuptake and degradation R-HSA-9609523, Insertion of tail-anchored proteins into the endoplasmic reticulum membrane |
SIGNORi | Q16623 |
Protein family/group databases
TCDBi | 1.F.1.1.1, the synaptosomal vesicle fusion pore (svf-pore) family 8.A.91.1.4, the syntaxin (syntaxin) family |
Names & Taxonomyi
Protein namesi | Recommended name: Syntaxin-1AAlternative name(s): Neuron-specific antigen HPC-1 |
Gene namesi | Name:STX1A Synonyms:STX1 |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
HGNCi | HGNC:11433, STX1A |
MIMi | 186590, gene |
neXtProti | NX_Q16623 |
VEuPathDBi | HostDB:ENSG00000106089.11 |
Subcellular locationi
Plasma membrane
- Cell membrane By similarity
Other locations
- synaptic vesicle membrane By similarity; Single-pass type IV membrane protein By similarity
- synaptosome By similarity
Note: Colocalizes with KCNB1 at the cell membrane.By similarity
Extracellular region or secreted
- Secreted Curated
Cytoskeleton
- actomyosin Source: Ensembl
Cytosol
- cytosol Source: Reactome
Extracellular region or secreted
- extracellular region Source: UniProtKB-SubCell
Nucleus
- nuclear membrane Source: Ensembl
Plasma Membrane
- integral component of presynaptic membrane Source: Ensembl
- plasma membrane Source: UniProtKB
- presynaptic active zone membrane Source: GO_Central
- presynaptic membrane Source: GO_Central
- voltage-gated potassium channel complex Source: Ensembl
Other locations
- axon Source: Ensembl
- endomembrane system Source: GO_Central
- glutamatergic synapse Source: Ensembl
- integral component of membrane Source: GO_Central
- integral component of synaptic vesicle membrane Source: Ensembl
- neuron projection Source: MGI
- postsynaptic density Source: Ensembl
- secretory granule Source: Ensembl
- SNARE complex Source: UniProtKB
- synaptic vesicle Source: GO_Central
- synaptobrevin 2-SNAP-25-syntaxin-1a complex Source: Ensembl
- synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex Source: Ensembl
- synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex Source: Ensembl
Topology
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Topological domaini | 1 – 265 | CytoplasmicSequence analysisAdd BLAST | 265 | |
Transmembranei | 266 – 286 | Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST | 21 | |
Topological domaini | 287 – 288 | ExtracellularSequence analysis | 2 |
Keywords - Cellular componenti
Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Secreted, Synapse, SynaptosomePathology & Biotechi
Involvement in diseasei
Mutagenesis
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Mutagenesisi | 252 | K → R: Complete loss of sumoylation; when associated with R-253 and R-256. 1 Publication | 1 | |
Mutagenesisi | 253 | K → R: Complete loss of sumoylation; when associated with R-252 and R-256. 1 Publication | 1 | |
Mutagenesisi | 256 | K → R: Complete loss of sumoylation; when associated with R-252 and R-253. 1 Publication | 1 |
Keywords - Diseasei
Williams-Beuren syndromeOrganism-specific databases
DisGeNETi | 6804 |
MalaCardsi | STX1A |
OpenTargetsi | ENSG00000106089 |
Orphaneti | 586, Cystic fibrosis |
PharmGKBi | PA36233 |
Miscellaneous databases
Pharosi | Q16623, Tbio |
Genetic variation databases
BioMutai | STX1A |
DMDMi | 2501084 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
ChainiPRO_0000210186 | 1 – 288 | Syntaxin-1AAdd BLAST | 288 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Modified residuei | 14 | PhosphoserineCombined sources | 1 | |
Modified residuei | 64 | PhosphoserineBy similarity | 1 | |
Modified residuei | 95 | PhosphoserineBy similarity | 1 | |
Modified residuei | 188 | Phosphoserine; by DAPK11 Publication | 1 | |
Cross-linki | 252 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication | ||
Cross-linki | 253 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication | ||
Cross-linki | 256 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication |
Post-translational modificationi
Keywords - PTMi
Isopeptide bond, Phosphoprotein, Ubl conjugationProteomic databases
jPOSTi | Q16623 |
MassIVEi | Q16623 |
PaxDbi | Q16623 |
PeptideAtlasi | Q16623 |
PRIDEi | Q16623 |
ProteomicsDBi | 60963 [Q16623-1] 60964 [Q16623-2] 60965 [Q16623-3] 69314 |
PTM databases
iPTMneti | Q16623 |
PhosphoSitePlusi | Q16623 |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000106089, Expressed in frontal cortex and 139 other tissues |
ExpressionAtlasi | Q16623, baseline and differential |
Genevisiblei | Q16623, HS |
Organism-specific databases
HPAi | ENSG00000106089, Group enriched (brain, pituitary gland) |
Interactioni
Subunit structurei
Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A; this complex constitutes the basic catalytic machinery of the complex neurotransmitter release apparatus (PubMed:26635000). The SNARE complex interacts with CPLX1 (By similarity).
Interacts with STXBP1 (PubMed:12730201, PubMed:26635000).
Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity).
Interacts with SYTL4 (By similarity).
Interacts with STXBP6 (By similarity).
Interacts with PLCL1 (via C2 domain) (By similarity).
Interacts with OTOF (By similarity).
Interacts with LGI3 (By similarity).
Interacts with SLC6A4 (By similarity).
Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent (By similarity).
Interacts with VAMP8 (PubMed:12130530).
Interacts with SNAP23 (PubMed:12130530).
Interacts with VAPA and SYBU (PubMed:15459722).
Interacts with PRRT2 (By similarity).
Interacts with SEPT8 (By similarity).
Interacts with STXBP5L (By similarity).
Interacts with synaptotagmin-1/SYT1 (By similarity).
By similarity4 PublicationsBinary interactionsi
Q16623
GO - Molecular functioni
- ATP-dependent protein binding Source: Ensembl
- calcium-dependent protein binding Source: Ensembl
- identical protein binding Source: IntAct
- ion channel binding Source: Ensembl
- kinase binding Source: UniProtKB
- myosin head/neck binding Source: Ensembl
- protein domain specific binding Source: Ensembl
- protein N-terminus binding Source: Ensembl
- SNARE binding Source: GO_Central
Protein-protein interaction databases
BioGRIDi | 112676, 174 interactors |
CORUMi | Q16623 |
DIPi | DIP-390N |
IntActi | Q16623, 135 interactors |
STRINGi | 9606.ENSP00000222812 |
Miscellaneous databases
RNActi | Q16623, protein |
Family & Domainsi
Domains and Repeats
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Domaini | 192 – 254 | t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST | 63 |
Coiled coil
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Coiled coili | 68 – 109 | Sequence analysisAdd BLAST | 42 |
Sequence similaritiesi
Keywords - Domaini
Coiled coil, Transmembrane, Transmembrane helixPhylogenomic databases
eggNOGi | KOG0810, Eukaryota |
GeneTreei | ENSGT01010000222508 |
HOGENOMi | CLU_042423_2_2_1 |
InParanoidi | Q16623 |
OMAi | GQIRKQQ |
OrthoDBi | 1033833at2759 |
PhylomeDBi | Q16623 |
TreeFami | TF313763 |
Family and domain databases
CDDi | cd00179, SynN, 1 hit |
InterProi | View protein in InterPro IPR010989, SNARE IPR028669, STX1 IPR006012, Syntaxin/epimorphin_CS IPR006011, Syntaxin_N IPR000727, T_SNARE_dom |
PANTHERi | PTHR19957:SF84, PTHR19957:SF84, 1 hit |
Pfami | View protein in Pfam PF05739, SNARE, 1 hit PF00804, Syntaxin, 1 hit |
SMARTi | View protein in SMART SM00503, SynN, 1 hit SM00397, t_SNARE, 1 hit |
SUPFAMi | SSF47661, SSF47661, 1 hit |
PROSITEi | View protein in PROSITE PS00914, SYNTAXIN, 1 hit PS50192, T_SNARE, 1 hit |
s (3+)i Sequence
Sequence statusi: Complete.
This entry describes 3 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN
60 70 80 90 100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI
110 120 130 140 150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ
160 170 180 190 200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS
210 220 230 240 250
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD
260 270 280
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA
The sequence of this isoform differs from the canonical sequence as follows:
227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD
Computationally mapped potential isoform sequencesi
There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basketA0A0C4DFZ1 | A0A0C4DFZ1_HUMAN | Syntaxin-1A | STX1A | 260 | Annotation score: | ||
A8MZ54 | A8MZ54_HUMAN | Syntaxin-1A | STX1A | 280 | Annotation score: |
Sequence cautioni
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 73 | E → V in AAA20940 (Ref. 10) Curated | 1 | |
Sequence conflicti | 140 | D → V in AAA20940 (Ref. 10) Curated | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_006338 | 227 – 288 | GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsAdd BLAST | 62 | |
Alternative sequenceiVSP_006339 | 227 – 288 | GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationAdd BLAST | 62 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L37792 mRNA Translation: AAA53519.1 U87315 , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2 U87315 , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2 D37932 mRNA Translation: BAA07151.1 AB086954 mRNA Translation: BAC78519.1 AC073846 Genomic DNA Translation: AAS07470.1 CH471200 Genomic DNA Translation: EAW69650.1 BC000444 mRNA No translation available. BC003011 mRNA Translation: AAH03011.1 BC064644 mRNA Translation: AAH64644.1 U12918 mRNA Translation: AAA20940.1 Different initiation. |
CCDSi | CCDS34655.1 [Q16623-1] CCDS55120.1 [Q16623-3] |
RefSeqi | NP_001159375.1, NM_001165903.1 [Q16623-3] NP_004594.1, NM_004603.3 [Q16623-1] |
Genome annotation databases
Ensembli | ENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1] ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3] |
GeneIDi | 6804 |
KEGGi | hsa:6804 |
UCSCi | uc003tyy.4, human [Q16623-1] |
Keywords - Coding sequence diversityi
Alternative splicingSimilar proteinsi
Cross-referencesi
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L37792 mRNA Translation: AAA53519.1 U87315 , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2 U87315 , AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2 D37932 mRNA Translation: BAA07151.1 AB086954 mRNA Translation: BAC78519.1 AC073846 Genomic DNA Translation: AAS07470.1 CH471200 Genomic DNA Translation: EAW69650.1 BC000444 mRNA No translation available. BC003011 mRNA Translation: AAH03011.1 BC064644 mRNA Translation: AAH64644.1 U12918 mRNA Translation: AAA20940.1 Different initiation. |
CCDSi | CCDS34655.1 [Q16623-1] CCDS55120.1 [Q16623-3] |
RefSeqi | NP_001159375.1, NM_001165903.1 [Q16623-3] NP_004594.1, NM_004603.3 [Q16623-1] |
3D structure databases
BMRBi | Q16623 |
SMRi | Q16623 |
ModBasei | Search... |
Protein-protein interaction databases
BioGRIDi | 112676, 174 interactors |
CORUMi | Q16623 |
DIPi | DIP-390N |
IntActi | Q16623, 135 interactors |
STRINGi | 9606.ENSP00000222812 |
Protein family/group databases
TCDBi | 1.F.1.1.1, the synaptosomal vesicle fusion pore (svf-pore) family 8.A.91.1.4, the syntaxin (syntaxin) family |
PTM databases
iPTMneti | Q16623 |
PhosphoSitePlusi | Q16623 |
Genetic variation databases
BioMutai | STX1A |
DMDMi | 2501084 |
Proteomic databases
jPOSTi | Q16623 |
MassIVEi | Q16623 |
PaxDbi | Q16623 |
PeptideAtlasi | Q16623 |
PRIDEi | Q16623 |
ProteomicsDBi | 60963 [Q16623-1] 60964 [Q16623-2] 60965 [Q16623-3] 69314 |
Protocols and materials databases
Antibodypediai | 3644, 671 antibodies |
DNASUi | 6804 |
Genome annotation databases
Ensembli | ENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1] ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3] |
GeneIDi | 6804 |
KEGGi | hsa:6804 |
UCSCi | uc003tyy.4, human [Q16623-1] |
Organism-specific databases
CTDi | 6804 |
DisGeNETi | 6804 |
GeneCardsi | STX1A |
HGNCi | HGNC:11433, STX1A |
HPAi | ENSG00000106089, Group enriched (brain, pituitary gland) |
MalaCardsi | STX1A |
MIMi | 186590, gene |
neXtProti | NX_Q16623 |
OpenTargetsi | ENSG00000106089 |
Orphaneti | 586, Cystic fibrosis |
PharmGKBi | PA36233 |
VEuPathDBi | HostDB:ENSG00000106089.11 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | KOG0810, Eukaryota |
GeneTreei | ENSGT01010000222508 |
HOGENOMi | CLU_042423_2_2_1 |
InParanoidi | Q16623 |
OMAi | GQIRKQQ |
OrthoDBi | 1033833at2759 |
PhylomeDBi | Q16623 |
TreeFami | TF313763 |
Enzyme and pathway databases
PathwayCommonsi | Q16623 |
Reactomei | R-HSA-181429, Serotonin Neurotransmitter Release Cycle R-HSA-181430, Norepinephrine Neurotransmitter Release Cycle R-HSA-210500, Glutamate Neurotransmitter Release Cycle R-HSA-212676, Dopamine Neurotransmitter Release Cycle R-HSA-264642, Acetylcholine Neurotransmitter Release Cycle R-HSA-264876, Insulin processing R-HSA-422356, Regulation of insulin secretion R-HSA-449836, Other interleukin signaling R-HSA-5250971, Toxicity of botulinum toxin type C (BoNT/C) R-HSA-5682910, LGI-ADAM interactions R-HSA-6794361, Neurexins and neuroligins R-HSA-888590, GABA synthesis, release, reuptake and degradation R-HSA-9609523, Insertion of tail-anchored proteins into the endoplasmic reticulum membrane |
SIGNORi | Q16623 |
Miscellaneous databases
BioGRID-ORCSi | 6804, 7 hits in 876 CRISPR screens |
ChiTaRSi | STX1A, human |
GeneWikii | STX1A |
GenomeRNAii | 6804 |
Pharosi | Q16623, Tbio |
PROi | PR:Q16623 |
RNActi | Q16623, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000106089, Expressed in frontal cortex and 139 other tissues |
ExpressionAtlasi | Q16623, baseline and differential |
Genevisiblei | Q16623, HS |
Family and domain databases
CDDi | cd00179, SynN, 1 hit |
InterProi | View protein in InterPro IPR010989, SNARE IPR028669, STX1 IPR006012, Syntaxin/epimorphin_CS IPR006011, Syntaxin_N IPR000727, T_SNARE_dom |
PANTHERi | PTHR19957:SF84, PTHR19957:SF84, 1 hit |
Pfami | View protein in Pfam PF05739, SNARE, 1 hit PF00804, Syntaxin, 1 hit |
SMARTi | View protein in SMART SM00503, SynN, 1 hit SM00397, t_SNARE, 1 hit |
SUPFAMi | SSF47661, SSF47661, 1 hit |
PROSITEi | View protein in PROSITE PS00914, SYNTAXIN, 1 hit PS50192, T_SNARE, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | STX1A_HUMAN | |
Accessioni | Q16623Primary (citable) accession number: Q16623 Secondary accession number(s): O15447 Q9BPZ6 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | November 1, 1997 |
Last sequence update: | November 1, 1996 | |
Last modified: | February 10, 2021 | |
This is version 206 of the entry and version 1 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
Reference proteomeDocuments
- Human chromosome 7
Human chromosome 7: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families