Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q16623 (STX1A_HUMAN)

Protein

Syntaxin-1A

Gene

STX1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processExocytosis, Neurotransmitter transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q16623

Protein family/group databases

Transport Classification Database

More...TCDBi		1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Syntaxin-1A
Alternative name(s):
Neuron-specific antigen HPC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STX1A
Synonyms:STX1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000106089.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:11433 STX1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		186590 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q16623

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 265CytoplasmicSequence analysisAdd BLAST265
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei266 – 286Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini287 – 288ExtracellularSequence analysis2

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.1 Publication

Keywords - Diseasei

Williams-Beuren syndrome

Organism-specific databases

DisGeNET

More...DisGeNETi		6804

MalaCards human disease database

More...MalaCardsi		STX1A

Open Targets

More...OpenTargetsi		ENSG00000106089

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		586 Cystic fibrosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36233

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STX1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		2501084

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002101861 – 288Syntaxin-1AAdd BLAST288

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14PhosphoserineCombined sources1
Modified residuei64PhosphoserineBy similarity1
Modified residuei95PhosphoserineBy similarity1
Modified residuei188Phosphoserine; by DAPK11 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q16623

PeptideAtlas

More...PeptideAtlasi		Q16623

PRoteomics IDEntifications database

More...PRIDEi		Q16623

ProteomicsDB human proteome resource

More...ProteomicsDBi		60963
60964 [Q16623-2]
60965 [Q16623-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q16623

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q16623

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex

CleanEx database of gene expression profiles

More...CleanExi		HS_STX1A

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q16623 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q16623 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB008372
HPA069176

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity). Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A (By similarity). This complex binds to CPLX1 (By similarity). Binds SYTL4 and STXBP6 (By similarity). Found in a ternary complex with STX1A and SNAP25 (By similarity). Interacts with PLCL1 (via C2 domain) (By similarity). Interacts with OTOF and LGI3 (By similarity). Interacts with SLC6A4 (By similarity). Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent (By similarity). Found in a complex with VAMP8 and SNAP23 (PubMed:12130530). Interacts with VAPA and SYBU (PubMed:15459722). Interacts with STXBP1 and DAPK1 (PubMed:12730201). Interacts with PRRT2 (By similarity). Interacts with SEPT8 (By similarity).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		112676, 56 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q16623

Database of interacting proteins

More...DIPi		DIP-390N

Protein interaction database and analysis system

More...IntActi		Q16623, 122 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000222812

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q16623

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q16623

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini192 – 254t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili68 – 109Sequence analysisAdd BLAST42

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the syntaxin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0810 Eukaryota
COG5074 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154060

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000286023

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG000497

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q16623

KEGG Orthology (KO)

More...KOi		K04560

Identification of Orthologs from Complete Genome Data

More...OMAi		FEEIDHI

Database of Orthologous Groups

More...OrthoDBi		EOG091G0EUK

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q16623

TreeFam database of animal gene trees

More...TreeFami		TF313763

Family and domain databases

Conserved Domains Database

More...CDDi		cd00179 SynN, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR010989 SNARE
IPR028669 STX1A
IPR006012 Syntaxin/epimorphin_CS
IPR006011 Syntaxin_N
IPR000727 T_SNARE_dom

The PANTHER Classification System

More...PANTHERi		PTHR19957:SF84 PTHR19957:SF84, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05739 SNARE, 1 hit
PF00804 Syntaxin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00503 SynN, 1 hit
SM00397 t_SNARE, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47661 SSF47661, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16623-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN 
        60         70         80         90        100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI 
       110        120        130        140        150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ 
       160        170        180        190        200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS 
       210        220        230        240        250
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD 
       260        270        280 
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA
Length:288
Mass (Da):33,023
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8AC787EFCE65ACA1
GO
Isoform 2 (identifier: Q16623-2) [UniParc]FASTAAdd to basket
Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.
Show »
Length:260
Mass (Da):29,632
Checksum:i546C1582FE83499E
GO
Isoform 3 (identifier: Q16623-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

Show »
Length:251
Mass (Da):28,995
Checksum:iC885D46384137E0B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MZ54A8MZ54_HUMAN
Syntaxin-1A
STX1A
280Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DFZ1A0A0C4DFZ1_HUMAN
Syntaxin-1A
STX1A
260Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA20940 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti73E → V in AAA20940 (Ref. 10) Curated1
Sequence conflicti140D → V in AAA20940 (Ref. 10) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006338227 – 288GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_006339227 – 288GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L37792 mRNA Translation: AAA53519.1
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2
D37932 mRNA Translation: BAA07151.1
AB086954 mRNA Translation: BAC78519.1
AC073846 Genomic DNA Translation: AAS07470.1
CH471200 Genomic DNA Translation: EAW69650.1
BC000444 mRNA No translation available.
BC003011 mRNA Translation: AAH03011.1
BC064644 mRNA Translation: AAH64644.1
U12918 mRNA Translation: AAA20940.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34655.1 [Q16623-1]
CCDS55120.1 [Q16623-3]

NCBI Reference Sequences

More...RefSeqi		NP_001159375.1, NM_001165903.1 [Q16623-3]
NP_004594.1, NM_004603.3 [Q16623-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.647024

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6804

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6804

UCSC genome browser

More...UCSCi		uc003tyy.4 human [Q16623-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L37792 mRNA Translation: AAA53519.1
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2
D37932 mRNA Translation: BAA07151.1
AB086954 mRNA Translation: BAC78519.1
AC073846 Genomic DNA Translation: AAS07470.1
CH471200 Genomic DNA Translation: EAW69650.1
BC000444 mRNA No translation available.
BC003011 mRNA Translation: AAH03011.1
BC064644 mRNA Translation: AAH64644.1
U12918 mRNA Translation: AAA20940.1 Different initiation.
CCDSiCCDS34655.1 [Q16623-1]
CCDS55120.1 [Q16623-3]
RefSeqiNP_001159375.1, NM_001165903.1 [Q16623-3]
NP_004594.1, NM_004603.3 [Q16623-1]
UniGeneiHs.647024

3D structure databases

ProteinModelPortaliQ16623
SMRiQ16623
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112676, 56 interactors
CORUMiQ16623
DIPiDIP-390N
IntActiQ16623, 122 interactors
STRINGi9606.ENSP00000222812

Protein family/group databases

TCDBi1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

PTM databases

iPTMnetiQ16623
PhosphoSitePlusiQ16623

Polymorphism and mutation databases

BioMutaiSTX1A
DMDMi2501084

Proteomic databases

PaxDbiQ16623
PeptideAtlasiQ16623
PRIDEiQ16623
ProteomicsDBi60963
60964 [Q16623-2]
60965 [Q16623-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		6804
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]
GeneIDi6804
KEGGihsa:6804
UCSCiuc003tyy.4 human [Q16623-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6804
DisGeNETi6804
EuPathDBiHostDB:ENSG00000106089.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		STX1A
HGNCiHGNC:11433 STX1A
HPAiCAB008372
HPA069176
MalaCardsiSTX1A
MIMi186590 gene
neXtProtiNX_Q16623
OpenTargetsiENSG00000106089
Orphaneti586 Cystic fibrosis
PharmGKBiPA36233

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0810 Eukaryota
COG5074 LUCA
GeneTreeiENSGT00940000154060
HOGENOMiHOG000286023
HOVERGENiHBG000497
InParanoidiQ16623
KOiK04560
OMAiFEEIDHI
OrthoDBiEOG091G0EUK
PhylomeDBiQ16623
TreeFamiTF313763

Enzyme and pathway databases

ReactomeiR-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORiQ16623

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		STX1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6804

Protein Ontology

More...PROi		PR:Q16623

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex
CleanExiHS_STX1A
ExpressionAtlasiQ16623 baseline and differential
GenevisibleiQ16623 HS

Family and domain databases

CDDicd00179 SynN, 1 hit
InterProiView protein in InterPro
IPR010989 SNARE
IPR028669 STX1A
IPR006012 Syntaxin/epimorphin_CS
IPR006011 Syntaxin_N
IPR000727 T_SNARE_dom
PANTHERiPTHR19957:SF84 PTHR19957:SF84, 1 hit
PfamiView protein in Pfam
PF05739 SNARE, 1 hit
PF00804 Syntaxin, 1 hit
SMARTiView protein in SMART
SM00503 SynN, 1 hit
SM00397 t_SNARE, 1 hit
SUPFAMiSSF47661 SSF47661, 1 hit
PROSITEiView protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTX1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16623
Secondary accession number(s): O15447
, O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 189 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again