Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Syntaxin-1A

Gene

STX1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processExocytosis, Neurotransmitter transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORiQ16623

Protein family/group databases

TCDBi1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Syntaxin-1A
Alternative name(s):
Neuron-specific antigen HPC-1
Gene namesi
Name:STX1A
Synonyms:STX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000106089.11
HGNCiHGNC:11433 STX1A
MIMi186590 gene
neXtProtiNX_Q16623

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 265CytoplasmicSequence analysisAdd BLAST265
Transmembranei266 – 286Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini287 – 288ExtracellularSequence analysis2

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane, Secreted, Synapse, Synaptosome

Pathology & Biotechi

Involvement in diseasei

STX1A is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.1 Publication

Keywords - Diseasei

Williams-Beuren syndrome

Organism-specific databases

DisGeNETi6804
MalaCardsiSTX1A
OpenTargetsiENSG00000106089
Orphaneti586 Cystic fibrosis
PharmGKBiPA36233

Polymorphism and mutation databases

BioMutaiSTX1A
DMDMi2501084

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002101861 – 288Syntaxin-1AAdd BLAST288

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14PhosphoserineCombined sources1
Modified residuei64PhosphoserineBy similarity1
Modified residuei95PhosphoserineBy similarity1
Modified residuei188Phosphoserine; by DAPK11 Publication1

Post-translational modificationi

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ16623
PeptideAtlasiQ16623
PRIDEiQ16623
ProteomicsDBi60963
60964 [Q16623-2]
60965 [Q16623-3]

PTM databases

iPTMnetiQ16623
PhosphoSitePlusiQ16623

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.1 Publication

Gene expression databases

BgeeiENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex
CleanExiHS_STX1A
ExpressionAtlasiQ16623 baseline and differential
GenevisibleiQ16623 HS

Organism-specific databases

HPAiCAB008372
HPA069176

Interactioni

Subunit structurei

Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity). Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A (By similarity). This complex binds to CPLX1 (By similarity). Binds SYTL4 and STXBP6 (By similarity). Found in a ternary complex with STX1A and SNAP25 (By similarity). Interacts with PLCL1 (via C2 domain) (By similarity). Interacts with OTOF and LGI3 (By similarity). Interacts with SLC6A4 (By similarity). Interacts with SYT6 and SYT8; the interaction is Ca2+-dependent (By similarity). Found in a complex with VAMP8 and SNAP23 (PubMed:12130530). Interacts with VAPA and SYBU (PubMed:15459722). Interacts with STXBP1 and DAPK1 (PubMed:12730201). Interacts with PRRT2 (By similarity).By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112676, 56 interactors
CORUMiQ16623
DIPiDIP-390N
IntActiQ16623, 121 interactors
STRINGi9606.ENSP00000222812

Structurei

3D structure databases

ProteinModelPortaliQ16623
SMRiQ16623
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini192 – 254t-SNARE coiled-coil homologyPROSITE-ProRule annotationAdd BLAST63

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili68 – 109Sequence analysisAdd BLAST42

Sequence similaritiesi

Belongs to the syntaxin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0810 Eukaryota
COG5074 LUCA
GeneTreeiENSGT00760000119200
HOGENOMiHOG000286023
HOVERGENiHBG000497
InParanoidiQ16623
KOiK04560
OMAiMGQEQSF
OrthoDBiEOG091G0EUK
PhylomeDBiQ16623
TreeFamiTF313763

Family and domain databases

CDDicd00179 SynN, 1 hit
InterProiView protein in InterPro
IPR010989 SNARE
IPR028669 STX1A
IPR006012 Syntaxin/epimorphin_CS
IPR006011 Syntaxin_N
IPR000727 T_SNARE_dom
PANTHERiPTHR19957:SF84 PTHR19957:SF84, 1 hit
PfamiView protein in Pfam
PF05739 SNARE, 1 hit
PF00804 Syntaxin, 1 hit
SMARTiView protein in SMART
SM00503 SynN, 1 hit
SM00397 t_SNARE, 1 hit
SUPFAMiSSF47661 SSF47661, 1 hit
PROSITEiView protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16623-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDRTQELRT AKDSDDDDDV AVTVDRDRFM DEFFEQVEEI RGFIDKIAEN
60 70 80 90 100
VEEVKRKHSA ILASPNPDEK TKEELEELMS DIKKTANKVR SKLKSIEQSI
110 120 130 140 150
EQEEGLNRSS ADLRIRKTQH STLSRKFVEV MSEYNATQSD YRERCKGRIQ
160 170 180 190 200
RQLEITGRTT TSEELEDMLE SGNPAIFASG IIMDSSISKQ ALSEIETRHS
210 220 230 240 250
EIIKLENSIR ELHDMFMDMA MLVESQGEMI DRIEYNVEHA VDYVERAVSD
260 270 280
TKKAVKYQSK ARRKKIMIII CCVILGIVIA STVGGIFA
Length:288
Mass (Da):33,023
Last modified:November 1, 1996 - v1
Checksum:i8AC787EFCE65ACA1
GO
Isoform 2 (identifier: Q16623-2) [UniParc]FASTAAdd to basket
Also known as: 1C

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → PQGAFLKSCPEPQPNREEGALWSSGAPGPAGRDD

Note: Expression is up-regulated by phorbol 12-myristate 13-acetate (PMA), but not by forskolin.
Show »
Length:260
Mass (Da):29,632
Checksum:i546C1582FE83499E
GO
Isoform 3 (identifier: Q16623-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-288: GEMIDRIEYN...IASTVGGIFA → TMWRGPCLTPRRPSSTRARRAGRKS

Show »
Length:251
Mass (Da):28,995
Checksum:iC885D46384137E0B
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MZ54A8MZ54_HUMAN
Syntaxin-1A
STX1A
280Annotation score:
A0A0C4DFZ1A0A0C4DFZ1_HUMAN
Syntaxin-1A
STX1A
260Annotation score:

Sequence cautioni

The sequence AAA20940 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti73E → V in AAA20940 (Ref. 10) Curated1
Sequence conflicti140D → V in AAA20940 (Ref. 10) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006338227 – 288GEMID…GGIFA → PQGAFLKSCPEPQPNREEGA LWSSGAPGPAGRDD in isoform 2. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_006339227 – 288GEMID…GGIFA → TMWRGPCLTPRRPSSTRARR AGRKS in isoform 3. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L37792 mRNA Translation: AAA53519.1
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2
D37932 mRNA Translation: BAA07151.1
AB086954 mRNA Translation: BAC78519.1
AC073846 Genomic DNA Translation: AAS07470.1
CH471200 Genomic DNA Translation: EAW69650.1
BC000444 mRNA No translation available.
BC003011 mRNA Translation: AAH03011.1
BC064644 mRNA Translation: AAH64644.1
U12918 mRNA Translation: AAA20940.1 Different initiation.
CCDSiCCDS34655.1 [Q16623-1]
CCDS55120.1 [Q16623-3]
RefSeqiNP_001159375.1, NM_001165903.1 [Q16623-3]
NP_004594.1, NM_004603.3 [Q16623-1]
UniGeneiHs.647024

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]
GeneIDi6804
KEGGihsa:6804
UCSCiuc003tyy.4 human [Q16623-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L37792 mRNA Translation: AAA53519.1
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAK54507.2
U87315
, AF297001, AF297002, U87310, AF297003, U87314 Genomic DNA Translation: AAB65500.2
D37932 mRNA Translation: BAA07151.1
AB086954 mRNA Translation: BAC78519.1
AC073846 Genomic DNA Translation: AAS07470.1
CH471200 Genomic DNA Translation: EAW69650.1
BC000444 mRNA No translation available.
BC003011 mRNA Translation: AAH03011.1
BC064644 mRNA Translation: AAH64644.1
U12918 mRNA Translation: AAA20940.1 Different initiation.
CCDSiCCDS34655.1 [Q16623-1]
CCDS55120.1 [Q16623-3]
RefSeqiNP_001159375.1, NM_001165903.1 [Q16623-3]
NP_004594.1, NM_004603.3 [Q16623-1]
UniGeneiHs.647024

3D structure databases

ProteinModelPortaliQ16623
SMRiQ16623
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112676, 56 interactors
CORUMiQ16623
DIPiDIP-390N
IntActiQ16623, 121 interactors
STRINGi9606.ENSP00000222812

Protein family/group databases

TCDBi1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family
8.A.91.1.4 the syntaxin (syntaxin) family

PTM databases

iPTMnetiQ16623
PhosphoSitePlusiQ16623

Polymorphism and mutation databases

BioMutaiSTX1A
DMDMi2501084

Proteomic databases

PaxDbiQ16623
PeptideAtlasiQ16623
PRIDEiQ16623
ProteomicsDBi60963
60964 [Q16623-2]
60965 [Q16623-3]

Protocols and materials databases

DNASUi6804
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222812; ENSP00000222812; ENSG00000106089 [Q16623-1]
ENST00000395156; ENSP00000378585; ENSG00000106089 [Q16623-3]
GeneIDi6804
KEGGihsa:6804
UCSCiuc003tyy.4 human [Q16623-1]

Organism-specific databases

CTDi6804
DisGeNETi6804
EuPathDBiHostDB:ENSG00000106089.11
GeneCardsiSTX1A
HGNCiHGNC:11433 STX1A
HPAiCAB008372
HPA069176
MalaCardsiSTX1A
MIMi186590 gene
neXtProtiNX_Q16623
OpenTargetsiENSG00000106089
Orphaneti586 Cystic fibrosis
PharmGKBiPA36233
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0810 Eukaryota
COG5074 LUCA
GeneTreeiENSGT00760000119200
HOGENOMiHOG000286023
HOVERGENiHBG000497
InParanoidiQ16623
KOiK04560
OMAiMGQEQSF
OrthoDBiEOG091G0EUK
PhylomeDBiQ16623
TreeFamiTF313763

Enzyme and pathway databases

ReactomeiR-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-264876 Insulin processing
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORiQ16623

Miscellaneous databases

GeneWikiiSTX1A
GenomeRNAii6804
PROiPR:Q16623
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106089 Expressed in 121 organ(s), highest expression level in frontal cortex
CleanExiHS_STX1A
ExpressionAtlasiQ16623 baseline and differential
GenevisibleiQ16623 HS

Family and domain databases

CDDicd00179 SynN, 1 hit
InterProiView protein in InterPro
IPR010989 SNARE
IPR028669 STX1A
IPR006012 Syntaxin/epimorphin_CS
IPR006011 Syntaxin_N
IPR000727 T_SNARE_dom
PANTHERiPTHR19957:SF84 PTHR19957:SF84, 1 hit
PfamiView protein in Pfam
PF05739 SNARE, 1 hit
PF00804 Syntaxin, 1 hit
SMARTiView protein in SMART
SM00503 SynN, 1 hit
SM00397 t_SNARE, 1 hit
SUPFAMiSSF47661 SSF47661, 1 hit
PROSITEiView protein in PROSITE
PS00914 SYNTAXIN, 1 hit
PS50192 T_SNARE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTX1A_HUMAN
AccessioniPrimary (citable) accession number: Q16623
Secondary accession number(s): O15447
, O15448, Q12936, Q75MD9, Q7Z5K3, Q9BPZ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: October 10, 2018
This is version 187 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again