Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuronal regeneration-related protein

Gene

NREP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.By similarity2 Publications

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal regeneration-related protein
Alternative name(s):
Neuronal protein 3.1
Protein p311
Gene namesi
Name:NREP
Synonyms:C5orf13, P311
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000134986.13
HGNCiHGNC:16834 NREP
MIMi607332 gene
neXtProtiNX_Q16612

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi59S → A: Reduces protein degradation and induces glioma cell migration. 1 Publication1
Mutagenesisi59S → D: Accelerates protein degradation and reduces glioma cell migration. 1 Publication1

Organism-specific databases

DisGeNETi9315
OpenTargetsiENSG00000134986
PharmGKBiPA128394547

Polymorphism and mutation databases

BioMutaiNREP
DMDMi2833275

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000579371 – 68Neuronal regeneration-related proteinAdd BLAST68

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei59Phosphoserine1 Publication1

Post-translational modificationi

Phosphorylated on Ser-59. Phosphorylation decreases stability and activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ16612
PRIDEiQ16612
ProteomicsDBi60949
60950 [Q16612-2]

PTM databases

iPTMnetiQ16612
PhosphoSitePlusiQ16612

Expressioni

Tissue specificityi

Expressed in lung (at protein level).1 Publication

Developmental stagei

In embryos of gestational week (gw) 24, detected mostly in the epithelial cells of saccular surfaces. In gw 39, detected in the cells lining the alveolar surfaces as well as in the mesenchyme (at protein level).1 Publication

Inductioni

Down-regulated in emphysematous lung compared to normal lung.1 Publication

Gene expression databases

BgeeiENSG00000134986
CleanExiHS_C5orf13
ExpressionAtlasiQ16612 baseline and differential
GenevisibleiQ16612 HS

Organism-specific databases

HPAiHPA000545

Interactioni

Subunit structurei

Interacts with the latency-associated peptides (LAP) of TGFB1 and TGFB2; the interaction results in a decrease in TGFB autoinduction (By similarity). Interacts with FLNA.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
EIF6P565375EBI-718657,EBI-372243

Protein-protein interaction databases

BioGridi114727, 7 interactors
IntActiQ16612, 5 interactors
MINTiQ16612

Structurei

3D structure databases

ProteinModelPortaliQ16612
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J38C Eukaryota
ENOG4111AXH LUCA
GeneTreeiENSGT00390000016521
HOGENOMiHOG000237339
HOVERGENiHBG052654
InParanoidiQ16612
OrthoDBiEOG091G14OY
PhylomeDBiQ16612
TreeFamiTF336368

Family and domain databases

InterProiView protein in InterPro
IPR024417 Neuronal_3.1
PANTHERiPTHR17102 PTHR17102, 1 hit
PfamiView protein in Pfam
PF11092 Alveol-reg_P311, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD019364 PD019364, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16612-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVYYPELFVW VSQEPFPNKD MEGRLPKGRL PVPKEVNRKK NDETNAASLT
60
PLGSSELRSP RISYLHFF
Length:68
Mass (Da):7,909
Last modified:November 1, 1996 - v1
Checksum:i4E612BC929D45122
GO
Isoform 2 (identifier: Q16612-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKGVWNYSALSRREDETRTQRSRMTDRVPCSKCFQVHCQISVLNC

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):13,081
Checksum:i60EE27856489627B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05123843E → G. Corresponds to variant dbSNP:rs11559Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0430131M → MKGVWNYSALSRREDETRTQ RSRMTDRVPCSKCFQVHCQI SVLNC in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36189 mRNA Translation: AAA93255.1
U30521 mRNA Translation: AAA74903.1
AK298779 mRNA Translation: BAH12868.1
AK315617 mRNA Translation: BAG37985.1
CH471086 Genomic DNA Translation: EAW49019.1
CH471086 Genomic DNA Translation: EAW49020.1
CH471086 Genomic DNA Translation: EAW49021.1
CH471086 Genomic DNA Translation: EAW49023.1
CH471086 Genomic DNA Translation: EAW49025.1
BC011050 mRNA Translation: AAH11050.1
BC019068 mRNA Translation: AAH19068.1
BC072013 mRNA Translation: AAH72013.1
BC072443 mRNA Translation: AAH72443.1
CCDSiCCDS4105.1 [Q16612-1]
CCDS47255.1 [Q16612-2]
PIRiG02089
RefSeqiNP_001135947.1, NM_001142475.1 [Q16612-2]
NP_001135948.1, NM_001142476.1 [Q16612-1]
NP_001135949.1, NM_001142477.1 [Q16612-1]
NP_001135950.1, NM_001142478.1 [Q16612-1]
NP_001135951.1, NM_001142479.1 [Q16612-1]
NP_001135952.1, NM_001142480.1 [Q16612-1]
NP_001135953.1, NM_001142481.1 [Q16612-1]
NP_001135954.1, NM_001142482.1 [Q16612-1]
NP_001135955.1, NM_001142483.1 [Q16612-1]
NP_004763.1, NM_004772.2 [Q16612-1]
UniGeneiHs.36053
Hs.732682
Hs.745061

Genome annotation databases

EnsembliENST00000257435; ENSP00000257435; ENSG00000134986 [Q16612-1]
ENST00000379671; ENSP00000368993; ENSG00000134986 [Q16612-1]
ENST00000395634; ENSP00000378996; ENSG00000134986 [Q16612-2]
ENST00000419114; ENSP00000399766; ENSG00000134986 [Q16612-1]
ENST00000446294; ENSP00000402965; ENSG00000134986 [Q16612-1]
ENST00000447165; ENSP00000408839; ENSG00000134986 [Q16612-1]
ENST00000450761; ENSP00000416617; ENSG00000134986 [Q16612-1]
ENST00000453526; ENSP00000403383; ENSG00000134986 [Q16612-1]
ENST00000455559; ENSP00000392559; ENSG00000134986 [Q16612-1]
ENST00000508870; ENSP00000427149; ENSG00000134986 [Q16612-1]
ENST00000509427; ENSP00000422630; ENSG00000134986 [Q16612-1]
GeneIDi9315
KEGGihsa:9315
UCSCiuc003kpl.3 human [Q16612-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNREP_HUMAN
AccessioniPrimary (citable) accession number: Q16612
Secondary accession number(s): B2RDN8, B7Z5D2, D3DSZ8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 20, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health