Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 214 (18 Sep 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Bcl-2 homologous antagonist/killer

Gene

BAK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi160Zinc; shared with dimeric partner1
Metal bindingi164Zinc; shared with dimeric partner1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111457 Release of apoptotic factors from the mitochondria

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q16611

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.21.1.3 the bcl-2 (bcl-2) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bcl-2 homologous antagonist/killer
Alternative name(s):
Apoptosis regulator BAK
Bcl-2-like protein 7
Short name:
Bcl2-L-7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BAK1
Synonyms:BAK, BCL2L7, CDN1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:949 BAK1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600516 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16611

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei188 – 205HelicalSequence analysisAdd BLAST18

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi164H → A: Strongly reduced zinc binding and homodimerization. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
578

Open Targets

More...
OpenTargetsi
ENSG00000030110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25253

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5609

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BAK1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2493274

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001430592 – 211Bcl-2 homologous antagonist/killerAdd BLAST210

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q16611

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q16611

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q16611

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16611

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16611

PeptideAtlas

More...
PeptideAtlasi
Q16611

PRoteomics IDEntifications database

More...
PRIDEi
Q16611

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60948 [Q16611-1]
7574

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q16611-1 [Q16611-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16611

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16611

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000030110 Expressed in 151 organ(s), highest expression level in mucosa of transverse colon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q16611 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16611 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB005029

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Formation of the homodimer is zinc-dependent (PubMed:17157251). Forms heterodimers with BCL2 and BCL2L1 isoform Bcl-X(L) (PubMed:9020082). Forms heterooligomers with BAX (PubMed:29531808).

Interacts with BCL2A1 (By similarity).

Interacts with RTL10/BOP (PubMed:23055042).

Interacts with VDAC1 (PubMed:25296756).

Interacts with GIMAP3/IAN4 and GIMAP5/IAN5 (PubMed:16509771).

By similarity6 Publications

(Microbial infection)

Interacts with vaccinia virus protein F1.

1 Publication

(Microbial infection)

Interacts with myxoma virus protein M11L.

1 Publication

(Microbial infection)

Interacts with Epstein-Barr virus protein BALF1.

1 Publication

(Microbial infection)

Interacts with adenovirus protein E1B 19K.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107054, 32 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1989 BAK1 oligomer

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q16611

Database of interacting proteins

More...
DIPi
DIP-935N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q16611

Protein interaction database and analysis system

More...
IntActi
Q16611, 28 interactors

Molecular INTeraction database

More...
MINTi
Q16611

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363591

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1211
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16611

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q16611

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi74 – 88BH3Add BLAST15
Motifi117 – 136BH1Add BLAST20
Motifi169 – 184BH2Add BLAST16

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4728 Eukaryota
ENOG41123S0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00970000193374

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006521

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16611

KEGG Orthology (KO)

More...
KOi
K14021

Identification of Orthologs from Complete Genome Data

More...
OMAi
INWGRVI

Database of Orthologous Groups

More...
OrthoDBi
1218929at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16611

TreeFam database of animal gene trees

More...
TreeFami
TF315834

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.437.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026308 BAK
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR020728 Bcl2_BH3_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam

The PANTHER Classification System

More...
PANTHERi
PTHR11256 PTHR11256, 1 hit
PTHR11256:SF41 PTHR11256:SF41, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00452 Bcl-2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01862 BCL2FAMILY

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56854 SSF56854, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01259 BH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16611-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASGQGPGPP RQECGEPALP SASEEQVAQD TEEVFRSYVF YRHQQEQEAE
60 70 80 90 100
GVAAPADPEM VTLPLQPSST MGQVGRQLAI IGDDINRRYD SEFQTMLQHL
110 120 130 140 150
QPTAENAYEY FTKIATSLFE SGINWGRVVA LLGFGYRLAL HVYQHGLTGF
160 170 180 190 200
LGQVTRFVVD FMLHHCIARW IAQRGGWVAA LNLGNGPILN VLVVLGVVLL
210
GQFVVRRFFK S
Length:211
Mass (Da):23,409
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA2200FE72A46D04E
GO
Isoform 2 (identifier: Q16611-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-153: SLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQ → RPAATPTACLRVASIGAVWWLFWASATVWPYTSTSMA
     154-211: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):16,872
Checksum:iE047A2DEE63C2E95
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRG8A0A0A0MRG8_HUMAN
Bcl-2 homologous antagonist/killer
BAK1
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01882928A → V1 PublicationCorresponds to variant dbSNP:rs4987115Ensembl.1
Natural variantiVAR_04841742R → H. Corresponds to variant dbSNP:rs1051911Ensembl.1
Natural variantiVAR_01883069S → R1 PublicationCorresponds to variant dbSNP:rs5745592Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056551117 – 153SLFES…GFLGQ → RPAATPTACLRVASIGAVWW LFWASATVWPYTSTSMA in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_056552154 – 211Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X84213 mRNA Translation: CAA58997.1
U23765 mRNA Translation: AAA93066.1
U16811 mRNA Translation: AAA74466.1
AY260471 Genomic DNA Translation: AAO74828.1
CR457419 mRNA Translation: CAG33700.1
Z93017 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03740.1
CH471081 Genomic DNA Translation: EAX03742.1
BC004431 mRNA Translation: AAH04431.1
BC110337 mRNA Translation: AAI10338.1
D88397 Genomic DNA Translation: BAA13606.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4781.1 [Q16611-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S58873

NCBI Reference Sequences

More...
RefSeqi
NP_001179.1, NM_001188.3 [Q16611-1]
XP_011513081.1, XM_011514779.2 [Q16611-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374467; ENSP00000363591; ENSG00000030110 [Q16611-1]
ENST00000442998; ENSP00000391258; ENSG00000030110 [Q16611-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
578

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:578

UCSC genome browser

More...
UCSCi
uc003oes.4 human [Q16611-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X84213 mRNA Translation: CAA58997.1
U23765 mRNA Translation: AAA93066.1
U16811 mRNA Translation: AAA74466.1
AY260471 Genomic DNA Translation: AAO74828.1
CR457419 mRNA Translation: CAG33700.1
Z93017 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03740.1
CH471081 Genomic DNA Translation: EAX03742.1
BC004431 mRNA Translation: AAH04431.1
BC110337 mRNA Translation: AAI10338.1
D88397 Genomic DNA Translation: BAA13606.1
CCDSiCCDS4781.1 [Q16611-1]
PIRiS58873
RefSeqiNP_001179.1, NM_001188.3 [Q16611-1]
XP_011513081.1, XM_011514779.2 [Q16611-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BXLNMR-B72-87[»]
2IMSX-ray1.48A16-186[»]
2IMTX-ray1.49A16-186[»]
2JBYX-ray2.41B67-92[»]
2JCNX-ray1.80A21-190[»]
2LP8NMR-B72-87[»]
2M5BNMR-A18-186[»]
2XPXX-ray2.05B67-92[»]
2YV6X-ray2.50A23-185[»]
3I1HX-ray2.20B72-87[»]
3QBRX-ray2.60B/Y63-96[»]
4D2LX-ray2.90B67-91[»]
4U2UX-ray2.90A/B23-186[»]
4U2VX-ray2.30A/B/C/D68-148[»]
4UF1X-ray2.30B67-92[»]
5AJKX-ray2.55B/D/F/H/J/L67-92[»]
5FMIX-ray1.49A23-184[»]
5FMKX-ray1.73B63-96[»]
5VWVX-ray1.90A23-186[»]
5VWWX-ray2.80A/B23-186[»]
5VWXX-ray2.49A/C23-186[»]
5VWYX-ray1.55A23-186[»]
5VWZX-ray1.62A/C23-186[»]
5VX0X-ray1.60A/C23-186[»]
5VX1X-ray1.22A/B23-186[»]
SMRiQ16611
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107054, 32 interactors
ComplexPortaliCPX-1989 BAK1 oligomer
CORUMiQ16611
DIPiDIP-935N
ELMiQ16611
IntActiQ16611, 28 interactors
MINTiQ16611
STRINGi9606.ENSP00000363591

Chemistry databases

ChEMBLiCHEMBL5609

Protein family/group databases

TCDBi1.A.21.1.3 the bcl-2 (bcl-2) family

PTM databases

iPTMnetiQ16611
PhosphoSitePlusiQ16611

Polymorphism and mutation databases

BioMutaiBAK1
DMDMi2493274

Proteomic databases

EPDiQ16611
jPOSTiQ16611
MassIVEiQ16611
MaxQBiQ16611
PaxDbiQ16611
PeptideAtlasiQ16611
PRIDEiQ16611
ProteomicsDBi60948 [Q16611-1]
7574
TopDownProteomicsiQ16611-1 [Q16611-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
578
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374467; ENSP00000363591; ENSG00000030110 [Q16611-1]
ENST00000442998; ENSP00000391258; ENSG00000030110 [Q16611-2]
GeneIDi578
KEGGihsa:578
UCSCiuc003oes.4 human [Q16611-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
578
DisGeNETi578

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BAK1
HGNCiHGNC:949 BAK1
HPAiCAB005029
MIMi600516 gene
neXtProtiNX_Q16611
OpenTargetsiENSG00000030110
PharmGKBiPA25253

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4728 Eukaryota
ENOG41123S0 LUCA
GeneTreeiENSGT00970000193374
HOGENOMiHOG000006521
InParanoidiQ16611
KOiK14021
OMAiINWGRVI
OrthoDBi1218929at2759
PhylomeDBiQ16611
TreeFamiTF315834

Enzyme and pathway databases

ReactomeiR-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111457 Release of apoptotic factors from the mitochondria
SIGNORiQ16611

Miscellaneous databases

EvolutionaryTraceiQ16611

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Bcl-2_homologous_antagonist_killer

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
578

Pharos

More...
Pharosi
Q16611

Protein Ontology

More...
PROi
PR:Q16611

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000030110 Expressed in 151 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasiQ16611 baseline and differential
GenevisibleiQ16611 HS

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR026308 BAK
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR020728 Bcl2_BH3_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF41 PTHR11256:SF41, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01259 BH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16611
Secondary accession number(s): C0H5Y7, Q6I9T6, Q92533
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: September 18, 2019
This is version 214 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again