Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2 homologous antagonist/killer

Gene

BAK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi160Zinc; shared with dimeric partner1
Metal bindingi164Zinc; shared with dimeric partner1

GO - Molecular functioni

  • BH domain binding Source: Ensembl
  • chaperone binding Source: Ensembl
  • heat shock protein binding Source: Ensembl
  • identical protein binding Source: IntAct
  • ion channel binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processApoptosis
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111457 Release of apoptotic factors from the mitochondria
SIGNORiQ16611

Protein family/group databases

TCDBi1.A.21.1.3 the bcl-2 (bcl-2) family

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2 homologous antagonist/killer
Alternative name(s):
Apoptosis regulator BAK
Bcl-2-like protein 7
Short name:
Bcl2-L-7
Gene namesi
Name:BAK1
Synonyms:BAK, BCL2L7, CDN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000030110.12
HGNCiHGNC:949 BAK1
MIMi600516 gene
neXtProtiNX_Q16611

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei188 – 205HelicalSequence analysisAdd BLAST18

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi164H → A: Strongly reduced zinc binding and homodimerization. 1 Publication1

Organism-specific databases

DisGeNETi578
OpenTargetsiENSG00000030110
PharmGKBiPA25253

Chemistry databases

ChEMBLiCHEMBL5609

Polymorphism and mutation databases

BioMutaiBAK1
DMDMi2493274

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001430592 – 211Bcl-2 homologous antagonist/killerAdd BLAST210

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ16611
MaxQBiQ16611
PaxDbiQ16611
PeptideAtlasiQ16611
PRIDEiQ16611
ProteomicsDBi60948
TopDownProteomicsiQ16611-1 [Q16611-1]

PTM databases

iPTMnetiQ16611
PhosphoSitePlusiQ16611

Expressioni

Tissue specificityi

Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.

Gene expression databases

BgeeiENSG00000030110
CleanExiHS_BAK1
ExpressionAtlasiQ16611 baseline and differential
GenevisibleiQ16611 HS

Organism-specific databases

HPAiCAB005029

Interactioni

Subunit structurei

Interacts with BCL2A1 (By similarity). Homodimer. Formation of the homodimer is zinc-dependent. Forms heterodimers with BCL2 and BCL2L1 isoform Bcl-X(L). Interacts with RTL10/BOP. Interacts with VDAC1 (PubMed:25296756).By similarity4 Publications
(Microbial infection) Interacts with vaccinia virus protein F1.1 Publication
(Microbial infection) Interacts with myxoma virus protein M11L.1 Publication
(Microbial infection) Interacts with Epstein-Barr virus protein BALF1.1 Publication
(Microbial infection) Interacts with adenovirus protein E1B 19K.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • BH domain binding Source: Ensembl
  • chaperone binding Source: Ensembl
  • heat shock protein binding Source: Ensembl
  • identical protein binding Source: IntAct
  • ion channel binding Source: UniProtKB
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi107054, 30 interactors
ComplexPortaliCPX-1989 BAK1 oligomer
CORUMiQ16611
DIPiDIP-935N
ELMiQ16611
IntActiQ16611, 28 interactors
MINTiQ16611
STRINGi9606.ENSP00000353878

Structurei

Secondary structure

1211
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi24 – 47Combined sources24
Beta strandi48 – 51Combined sources4
Turni58 – 61Combined sources4
Helixi70 – 79Combined sources10
Helixi84 – 100Combined sources17
Turni104 – 106Combined sources3
Helixi107 – 119Combined sources13
Helixi125 – 145Combined sources21
Beta strandi146 – 148Combined sources3
Helixi151 – 164Combined sources14
Helixi167 – 173Combined sources7
Helixi177 – 181Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BXLNMR-B72-87[»]
2IMSX-ray1.48A16-186[»]
2IMTX-ray1.49A16-186[»]
2JBYX-ray2.41B67-92[»]
2JCNX-ray1.80A21-190[»]
2LP8NMR-B72-87[»]
2M5BNMR-A18-186[»]
2XPXX-ray2.05B67-92[»]
2YV6X-ray2.50A23-185[»]
3I1HX-ray2.20B72-87[»]
3QBRX-ray2.60B/Y63-96[»]
4D2LX-ray2.90B67-91[»]
4U2UX-ray2.90A/B23-186[»]
4U2VX-ray2.30A/B/C/D68-148[»]
4UF1X-ray2.30B67-92[»]
5AJKX-ray2.55B/D/F/H/J/L67-92[»]
5FMIX-ray1.49A23-184[»]
5FMKX-ray1.73B63-96[»]
5VWVX-ray1.90A23-186[»]
5VWWX-ray2.80A/B23-186[»]
5VWXX-ray2.49A/C23-186[»]
5VWYX-ray1.55A23-186[»]
5VWZX-ray1.62A/C23-186[»]
5VX0X-ray1.60A/C23-186[»]
5VX1X-ray1.22A/B23-186[»]
ProteinModelPortaliQ16611
SMRiQ16611
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16611

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi74 – 88BH3Add BLAST15
Motifi117 – 136BH1Add BLAST20
Motifi169 – 184BH2Add BLAST16

Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4728 Eukaryota
ENOG41123S0 LUCA
GeneTreeiENSGT00530000062935
HOGENOMiHOG000006521
HOVERGENiHBG002674
InParanoidiQ16611
KOiK14021
OMAiINWGRVI
OrthoDBiEOG091G0OCU
PhylomeDBiQ16611
TreeFamiTF315834

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR026308 BAK
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR020728 Bcl2_BH3_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF41 PTHR11256:SF41, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01259 BH3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q16611-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASGQGPGPP RQECGEPALP SASEEQVAQD TEEVFRSYVF YRHQQEQEAE
60 70 80 90 100
GVAAPADPEM VTLPLQPSST MGQVGRQLAI IGDDINRRYD SEFQTMLQHL
110 120 130 140 150
QPTAENAYEY FTKIATSLFE SGINWGRVVA LLGFGYRLAL HVYQHGLTGF
160 170 180 190 200
LGQVTRFVVD FMLHHCIARW IAQRGGWVAA LNLGNGPILN VLVVLGVVLL
210
GQFVVRRFFK S
Length:211
Mass (Da):23,409
Last modified:November 1, 1996 - v1
Checksum:iA2200FE72A46D04E
GO
Isoform 2 (identifier: Q16611-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-153: SLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQ → RPAATPTACLRVASIGAVWWLFWASATVWPYTSTSMA
     154-211: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):16,872
Checksum:iE047A2DEE63C2E95
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01882928A → V1 PublicationCorresponds to variant dbSNP:rs4987115Ensembl.1
Natural variantiVAR_04841742R → H. Corresponds to variant dbSNP:rs1051911Ensembl.1
Natural variantiVAR_01883069S → R1 PublicationCorresponds to variant dbSNP:rs5745592Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056551117 – 153SLFES…GFLGQ → RPAATPTACLRVASIGAVWW LFWASATVWPYTSTSMA in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_056552154 – 211Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X84213 mRNA Translation: CAA58997.1
U23765 mRNA Translation: AAA93066.1
U16811 mRNA Translation: AAA74466.1
AY260471 Genomic DNA Translation: AAO74828.1
CR457419 mRNA Translation: CAG33700.1
Z93017 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03740.1
CH471081 Genomic DNA Translation: EAX03742.1
BC004431 mRNA Translation: AAH04431.1
BC110337 mRNA Translation: AAI10338.1
D88397 Genomic DNA Translation: BAA13606.1
CCDSiCCDS4781.1 [Q16611-1]
PIRiS58873
RefSeqiNP_001179.1, NM_001188.3 [Q16611-1]
XP_011513081.1, XM_011514779.2 [Q16611-1]
UniGeneiHs.485139

Genome annotation databases

EnsembliENST00000374467; ENSP00000363591; ENSG00000030110 [Q16611-1]
ENST00000442998; ENSP00000391258; ENSG00000030110 [Q16611-2]
GeneIDi578
KEGGihsa:578
UCSCiuc003oes.4 human [Q16611-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBAK_HUMAN
AccessioniPrimary (citable) accession number: Q16611
Secondary accession number(s): C0H5Y7, Q6I9T6, Q92533
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 20, 2018
This is version 203 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health