Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-G2

Gene

CCNG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May play a role in growth regulation and in negative regulation of cell cycle progression.

GO - Molecular functioni

  • cyclin-dependent protein serine/threonine kinase regulator activity Source: GO_Central
  • protein kinase binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionCyclin
Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

SignaLinkiQ16589

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-G2
Gene namesi
Name:CCNG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000138764.13
HGNCiHGNC:1593 CCNG2
MIMi603203 gene
neXtProtiNX_Q16589

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi901
OpenTargetsiENSG00000138764
PharmGKBiPA26158

Polymorphism and mutation databases

BioMutaiCCNG2
DMDMi9087132

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000804691 – 344Cyclin-G2Add BLAST344

Proteomic databases

PaxDbiQ16589
PeptideAtlasiQ16589
PRIDEiQ16589
ProteomicsDBi60937

PTM databases

iPTMnetiQ16589
PhosphoSitePlusiQ16589

Expressioni

Tissue specificityi

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

Developmental stagei

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

Inductioni

Activated by actinomycin-D induced DNA damage.

Gene expression databases

BgeeiENSG00000138764 Expressed in 235 organ(s), highest expression level in amniotic fluid
CleanExiHS_CCNG2
ExpressionAtlasiQ16589 baseline and differential
GenevisibleiQ16589 HS

Organism-specific databases

HPAiHPA034684

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107341, 13 interactors
IntActiQ16589, 2 interactors
MINTiQ16589
STRINGi9606.ENSP00000315743

Structurei

3D structure databases

ProteinModelPortaliQ16589
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cyclin family. Cyclin G subfamily.Curated

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00530000062971
HOGENOMiHOG000059559
HOVERGENiHBG050839
InParanoidiQ16589
KOiK10146
OMAiDLWSLTS
PhylomeDBiQ16589
TreeFamiTF101007

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR028895 CCNG2
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF60 PTHR10177:SF60, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT
60 70 80 90 100
LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC
110 120 130 140 150
IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH
160 170 180 190 200
YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK
210 220 230 240 250
AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK
260 270 280 290 300
CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD
310 320 330 340
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS
Length:344
Mass (Da):38,866
Last modified:November 1, 1996 - v1
Checksum:iD434E0CE92760301
GO
Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):34,522
Checksum:iEBEA3EDA34D693FE
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RHI3D6RHI3_HUMAN
Cyclin-G2
CCNG2
160Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti127R → W in CAG46997 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0143334L → V1 PublicationCorresponds to variant dbSNP:rs4150050Ensembl.1
Natural variantiVAR_01433428E → G1 PublicationCorresponds to variant dbSNP:rs4150051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053893304 – 344SEDSC…LCFPS → R in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA Translation: AAC50689.1
L49506 mRNA Translation: AAC41978.1
AF549495 Genomic DNA Translation: AAN40704.1
AK292029 mRNA Translation: BAF84718.1
AK293899 mRNA Translation: BAG57286.1
CR542181 mRNA Translation: CAG46978.1
CR542200 mRNA Translation: CAG46997.1
BT019503 mRNA Translation: AAV38310.1
AC008638 Genomic DNA No translation available.
AC092674 Genomic DNA No translation available.
AC104771 Genomic DNA No translation available.
AC108144 Genomic DNA No translation available.
AC112716 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05812.1
CCDSiCCDS3581.1 [Q16589-1]
RefSeqiNP_004345.1, NM_004354.2 [Q16589-1]
XP_011530700.1, XM_011532398.1 [Q16589-1]
XP_011530701.1, XM_011532399.2 [Q16589-1]
UniGeneiHs.740456

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764 [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764 [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764 [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764 [Q16589-2]
GeneIDi901
KEGGihsa:901
UCSCiuc003hkn.5 human [Q16589-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA Translation: AAC50689.1
L49506 mRNA Translation: AAC41978.1
AF549495 Genomic DNA Translation: AAN40704.1
AK292029 mRNA Translation: BAF84718.1
AK293899 mRNA Translation: BAG57286.1
CR542181 mRNA Translation: CAG46978.1
CR542200 mRNA Translation: CAG46997.1
BT019503 mRNA Translation: AAV38310.1
AC008638 Genomic DNA No translation available.
AC092674 Genomic DNA No translation available.
AC104771 Genomic DNA No translation available.
AC108144 Genomic DNA No translation available.
AC112716 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05812.1
CCDSiCCDS3581.1 [Q16589-1]
RefSeqiNP_004345.1, NM_004354.2 [Q16589-1]
XP_011530700.1, XM_011532398.1 [Q16589-1]
XP_011530701.1, XM_011532399.2 [Q16589-1]
UniGeneiHs.740456

3D structure databases

ProteinModelPortaliQ16589
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107341, 13 interactors
IntActiQ16589, 2 interactors
MINTiQ16589
STRINGi9606.ENSP00000315743

PTM databases

iPTMnetiQ16589
PhosphoSitePlusiQ16589

Polymorphism and mutation databases

BioMutaiCCNG2
DMDMi9087132

Proteomic databases

PaxDbiQ16589
PeptideAtlasiQ16589
PRIDEiQ16589
ProteomicsDBi60937

Protocols and materials databases

DNASUi901
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764 [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764 [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764 [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764 [Q16589-2]
GeneIDi901
KEGGihsa:901
UCSCiuc003hkn.5 human [Q16589-1]

Organism-specific databases

CTDi901
DisGeNETi901
EuPathDBiHostDB:ENSG00000138764.13
GeneCardsiCCNG2
HGNCiHGNC:1593 CCNG2
HPAiHPA034684
MIMi603203 gene
neXtProtiNX_Q16589
OpenTargetsiENSG00000138764
PharmGKBiPA26158
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00530000062971
HOGENOMiHOG000059559
HOVERGENiHBG050839
InParanoidiQ16589
KOiK10146
OMAiDLWSLTS
PhylomeDBiQ16589
TreeFamiTF101007

Enzyme and pathway databases

SignaLinkiQ16589

Miscellaneous databases

ChiTaRSiCCNG2 human
GeneWikiiCCNG2
GenomeRNAii901
PROiPR:Q16589
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138764 Expressed in 235 organ(s), highest expression level in amniotic fluid
CleanExiHS_CCNG2
ExpressionAtlasiQ16589 baseline and differential
GenevisibleiQ16589 HS

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR028895 CCNG2
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF60 PTHR10177:SF60, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCCNG2_HUMAN
AccessioniPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again