Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q16589 (CCNG2_HUMAN)

Entry version 162 (26 Feb 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cyclin-G2

Gene

CCNG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in growth regulation and in negative regulation of cell cycle progression.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCyclin
Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-9617828 FOXO-mediated transcription of cell cycle genes

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q16589

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-G2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCNG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1593 CCNG2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603203 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q16589

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		901

Open Targets

More...OpenTargetsi		ENSG00000138764

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26158

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q16589 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCNG2

Domain mapping of disease mutations (DMDM)

More...DMDMi		9087132

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000804691 – 344Cyclin-G2Add BLAST344

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q16589

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q16589

PeptideAtlas

More...PeptideAtlasi		Q16589

PRoteomics IDEntifications database

More...PRIDEi		Q16589

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4002
60937 [Q16589-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q16589

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q16589

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression levels increase through the cell cycle to peak in the mid/late-S phase and decrease during G2/M phase.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Activated by actinomycin-D induced DNA damage.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000138764 Expressed in amniotic fluid and 234 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q16589 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q16589 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA034684

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107341, 14 interactors

Protein interaction database and analysis system

More...IntActi		Q16589, 2 interactors

Molecular INTeraction database

More...MINTi		Q16589

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000315743

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q16589 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclin family. Cyclin G subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0653 Eukaryota
COG5024 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156423

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_062642_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q16589

KEGG Orthology (KO)

More...KOi		K10146

Identification of Orthologs from Complete Genome Data

More...OMAi		CWDESES

Database of Orthologous Groups

More...OrthoDBi		1015714at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q16589

TreeFam database of animal gene trees

More...TreeFami		TF101007

Family and domain databases

Conserved Domains Database

More...CDDi		cd00043 CYCLIN, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028895 CCNG2
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR006671 Cyclin_N

The PANTHER Classification System

More...PANTHERi		PTHR10177 PTHR10177, 1 hit
PTHR10177:SF60 PTHR10177:SF60, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00134 Cyclin_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00385 CYCLIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47954 SSF47954, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16589-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDLGAEHLA GHEGVQLLGL LNVYLEQEER FQPREKGLSL IEATPENDNT 
        60         70         80         90        100
LCPGLRNAKV EDLRSLANFF GSCTETFVLA VNILDRFLAL MKVKPKHLSC 
       110        120        130        140        150
IGVCSFLLAA RIVEEDCNIP STHDVIRISQ CKCTASDIKR MEKIISEKLH 
       160        170        180        190        200
YELEATTALN FLHLYHTIIL CHTSERKEIL SLDKLEAQLK ACNCRLIFSK 
       210        220        230        240        250
AKPSVLALCL LNLEVETLKS VELLEILLLV KKHSKINDTE FFYWRELVSK 
       260        270        280        290        300
CLAEYSSPEC CKPDLKKLVW IVSRRTAQNL HNSYYSVPEL PTIPEGGCFD 
       310        320        330        340 
ESESEDSCED MSCGEESLSS SPPSDQECTF FFNFKVAQTL CFPS
Length:344
Mass (Da):38,866
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD434E0CE92760301
GO
Isoform 2 (identifier: Q16589-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-344: SEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS → R

Show »
Length:304
Mass (Da):34,522
Checksum:iEBEA3EDA34D693FE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RHI3D6RHI3_HUMAN
Cyclin-G2
CCNG2
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti127R → W in CAG46997 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0143334L → V1 PublicationCorresponds to variant dbSNP:rs4150050Ensembl.1
Natural variantiVAR_01433428E → G1 PublicationCorresponds to variant dbSNP:rs4150051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053893304 – 344SEDSC…LCFPS → R in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U47414 mRNA Translation: AAC50689.1
L49506 mRNA Translation: AAC41978.1
AF549495 Genomic DNA Translation: AAN40704.1
AK292029 mRNA Translation: BAF84718.1
AK293899 mRNA Translation: BAG57286.1
CR542181 mRNA Translation: CAG46978.1
CR542200 mRNA Translation: CAG46997.1
BT019503 mRNA Translation: AAV38310.1
AC008638 Genomic DNA No translation available.
AC092674 Genomic DNA No translation available.
AC104771 Genomic DNA No translation available.
AC108144 Genomic DNA No translation available.
AC112716 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05812.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3581.1 [Q16589-1]

NCBI Reference Sequences

More...RefSeqi		NP_004345.1, NM_004354.2 [Q16589-1]
XP_011530700.1, XM_011532398.1 [Q16589-1]
XP_011530701.1, XM_011532399.2 [Q16589-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000316355; ENSP00000315743; ENSG00000138764 [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764 [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764 [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764 [Q16589-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		901

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:901

UCSC genome browser

More...UCSCi		uc003hkn.5 human [Q16589-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U47414 mRNA Translation: AAC50689.1
L49506 mRNA Translation: AAC41978.1
AF549495 Genomic DNA Translation: AAN40704.1
AK292029 mRNA Translation: BAF84718.1
AK293899 mRNA Translation: BAG57286.1
CR542181 mRNA Translation: CAG46978.1
CR542200 mRNA Translation: CAG46997.1
BT019503 mRNA Translation: AAV38310.1
AC008638 Genomic DNA No translation available.
AC092674 Genomic DNA No translation available.
AC104771 Genomic DNA No translation available.
AC108144 Genomic DNA No translation available.
AC112716 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05812.1
CCDSiCCDS3581.1 [Q16589-1]
RefSeqiNP_004345.1, NM_004354.2 [Q16589-1]
XP_011530700.1, XM_011532398.1 [Q16589-1]
XP_011530701.1, XM_011532399.2 [Q16589-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi107341, 14 interactors
IntActiQ16589, 2 interactors
MINTiQ16589
STRINGi9606.ENSP00000315743

PTM databases

iPTMnetiQ16589
PhosphoSitePlusiQ16589

Polymorphism and mutation databases

BioMutaiCCNG2
DMDMi9087132

Proteomic databases

MassIVEiQ16589
PaxDbiQ16589
PeptideAtlasiQ16589
PRIDEiQ16589
ProteomicsDBi4002
60937 [Q16589-1]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		901

Genome annotation databases

EnsembliENST00000316355; ENSP00000315743; ENSG00000138764 [Q16589-1]
ENST00000395640; ENSP00000379002; ENSG00000138764 [Q16589-1]
ENST00000502280; ENSP00000424665; ENSG00000138764 [Q16589-1]
ENST00000509972; ENSP00000426476; ENSG00000138764 [Q16589-2]
GeneIDi901
KEGGihsa:901
UCSCiuc003hkn.5 human [Q16589-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		901
DisGeNETi901

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCNG2
HGNCiHGNC:1593 CCNG2
HPAiHPA034684
MIMi603203 gene
neXtProtiNX_Q16589
OpenTargetsiENSG00000138764
PharmGKBiPA26158

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0653 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00940000156423
HOGENOMiCLU_062642_0_1_1
InParanoidiQ16589
KOiK10146
OMAiCWDESES
OrthoDBi1015714at2759
PhylomeDBiQ16589
TreeFamiTF101007

Enzyme and pathway databases

ReactomeiR-HSA-9617828 FOXO-mediated transcription of cell cycle genes
SignaLinkiQ16589

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCNG2 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CCNG2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		901
PharosiQ16589 Tbio

Protein Ontology

More...PROi		PR:Q16589
RNActiQ16589 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000138764 Expressed in amniotic fluid and 234 other tissues
ExpressionAtlasiQ16589 baseline and differential
GenevisibleiQ16589 HS

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR028895 CCNG2
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR006671 Cyclin_N
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF60 PTHR10177:SF60, 1 hit
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCNG2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16589
Secondary accession number(s): B4DF25, Q6FGA7, Q6FGC6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: February 26, 2020
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again