Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q16576 (RBBP7_HUMAN)

Entry version 207 (02 Jun 2021)
Sequence version 1 (01 Nov 1997)
Previous versions | rss
Add a publicationFeedback
Protein

Histone-binding protein RBBP7

Gene

RBBP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone, Chromatin regulator, Repressor
Biological processDNA replication, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q16576

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-212300, PRC2 methylates histones and DNA
R-HSA-2559580, Oxidative Stress Induced Senescence
R-HSA-3214815, HDACs deacetylate histones
R-HSA-3214841, PKMTs methylate histone lysines
R-HSA-3214847, HATs acetylate histones
R-HSA-3214858, RMTs methylate histone arginines
R-HSA-427389, ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-5617472, Activation of anterior HOX genes in hindbrain development during early embryogenesis
R-HSA-606279, Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-6804758, Regulation of TP53 Activity through Acetylation
R-HSA-73762, RNA Polymerase I Transcription Initiation
R-HSA-8943724, Regulation of PTEN gene transcription
R-HSA-8951664, Neddylation
R-HSA-8953750, Transcriptional Regulation by E2F6
R-HSA-9609690, HCMV Early Events
R-HSA-9679191, Potential therapeutics for SARS

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q16576

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Histone-binding protein RBBP7
Alternative name(s):
Histone acetyltransferase type B subunit 2
Nucleosome-remodeling factor subunit RBAP46
Retinoblastoma-binding protein 7
Short name:
RBBP-7
Retinoblastoma-binding protein p46
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBBP7
Synonyms:RBAP46
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9890, RBBP7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300825, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q16576

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000102054.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		5931

Open Targets

More...OpenTargetsi		ENSG00000102054

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA34254

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q16576, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3301388

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RBBP7

Domain mapping of disease mutations (DMDM)

More...DMDMi		2494891

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000511952 – 425Histone-binding protein RBBP7Add BLAST424
Isoform 2 (identifier: Q16576-2)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei3PhosphoserineCombined sources1
Modified residuei4N6-acetyllysine; alternateCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki4Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki4Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Modified residuei10PhosphothreonineCombined sources1
Modified residuei95PhosphoserineCombined sources1
Cross-linki101Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei119N6-acetyllysineBy similarity1
Cross-linki155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei159N6-acetyllysine; alternateBy similarity1
Cross-linki159Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei354PhosphoserineCombined sources1
Isoform 2 (identifier: Q16576-2)
Modified residuei2N-acetylalanineCombined sources1
Modified residuei13PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q16576

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q16576

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q16576

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q16576

PeptideAtlas

More...PeptideAtlasi		Q16576

PRoteomics IDEntifications database

More...PRIDEi		Q16576

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60926 [Q16576-1]
60927 [Q16576-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q16576

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q16576

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q16576

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q16576

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000102054, Expressed in right adrenal gland and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q16576, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q16576, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000102054, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds directly to helix 1 of the histone fold of histone H4, a region that is not accessible when H4 is in chromatin (PubMed:18571423). Subunit of the type B histone acetyltransferase (HAT) complex, composed of RBBP7 and HAT1. Subunit of the core histone deacetylase (HDAC) complex, which is composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core HDAC complex associates with SIN3A, ARID4B/SAP180, SAP18, SAP30, SAP130, SUDS3/SAP45 and possibly ARID4A/RBP1 and ING1 to form the SIN3 HDAC complex. The core HDAC complex may also associate with MTA2, MBD3, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylase complex (the NuRD complex). The NuRD complex may also interact with MBD3L1 and MBD3L2.

Interacts with MTA1. Subunit of the PRC2/EED-EZH2 complex, which is composed of at least EED, EZH2, RBBP4, RBBP7 and SUZ12 (PubMed:12435631). The PRC2/EED-EZH2 complex may also associate with HDAC1. Part of the nucleosome remodeling factor (NURF) complex which consists of SMARCA1; BPTF; RBBP4 and RBBP7.

Interacts with the viral protein-binding domain of the retinoblastoma protein (RB1) (PubMed:7503932, PubMed:10220405).

Interacts with CREBBP, and this interaction may be enhanced by the binding of phosphorylated CREB1 to CREBBP.

Interacts with BRCA1, HDAC7 and SUV39H1.

Interacts with CENPA (PubMed:25556658).

17 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111866, 260 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-3321, SIN3A histone deacetylase complex
CPX-3322, SIN3B histone deacetylase complex
CPX-3323, SIN3A histone deacetylase complex, ES cell-specific variant
CPX-688, NuRF chromatin remodelling complex
CPX-880, MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922, MBD3/NuRD nucleosome remodeling and deacetylase complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q16576

Database of interacting proteins

More...DIPi		DIP-436N

Protein interaction database and analysis system

More...IntActi		Q16576, 143 interactors

Molecular INTeraction database

More...MINTi		Q16576

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000369424

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q16576, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1425
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q16576

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q16576

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati47 – 122WD 1Add BLAST76
Repeati128 – 173WD 2Add BLAST46
Repeati181 – 217WD 3Add BLAST37
Repeati228 – 269WD 4Add BLAST42
Repeati275 – 312WD 5Add BLAST38
Repeati318 – 369WD 6Add BLAST52
Repeati376 – 403WD 7Add BLAST28

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0264, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154748

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q16576

Identification of Orthologs from Complete Genome Data

More...OMAi		PITDFNW

Database of Orthologous Groups

More...OrthoDBi		831322at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q16576

TreeFam database of animal gene trees

More...TreeFami		TF106485

Family and domain databases

Database of protein disorder

More...DisProti		DP01282

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00084

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR020472, G-protein_beta_WD-40_rep
IPR022052, Histone-bd_RBBP4_N
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12265, CAF1C_H4-bd, 1 hit
PF00400, WD40, 5 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00320, GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320, WD40, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00678, WD_REPEATS_1, 3 hits
PS50082, WD_REPEATS_2, 5 hits
PS50294, WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASKEMFEDT VEERVINEEY KIWKKNTPFL YDLVMTHALQ WPSLTVQWLP 
        60         70         80         90        100
EVTKPEGKDY ALHWLVLGTH TSDEQNHLVV ARVHIPNDDA QFDASHCDSD 
       110        120        130        140        150
KGEFGGFGSV TGKIECEIKI NHEGEVNRAR YMPQNPHIIA TKTPSSDVLV 
       160        170        180        190        200
FDYTKHPAKP DPSGECNPDL RLRGHQKEGY GLSWNSNLSG HLLSASDDHT 
       210        220        230        240        250
VCLWDINAGP KEGKIVDAKA IFTGHSAVVE DVAWHLLHES LFGSVADDQK 
       260        270        280        290        300
LMIWDTRSNT TSKPSHLVDA HTAEVNCLSF NPYSEFILAT GSADKTVALW 
       310        320        330        340        350
DLRNLKLKLH TFESHKDEIF QVHWSPHNET ILASSGTDRR LNVWDLSKIG 
       360        370        380        390        400
EEQSAEDAED GPPELLFIHG GHTAKISDFS WNPNEPWVIC SVSEDNIMQI 
       410        420 
WQMAENIYND EESDVTTSEL EGQGS
Length:425
Mass (Da):47,820
Last modified:November 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1A4B4CD1A8E96815
GO
Isoform 2 (identifier: Q16576-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MASKEM → MAAEAGVVGAGASPDGDWRDQACGLLLHVHLSSRLGRAAPVRTGRHLRTV

Show »
Length:469
Mass (Da):52,314
Checksum:iD668D0B6D5715261
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PC52E9PC52_HUMAN
Histone-binding protein RBBP7
RBBP7
416Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JP01Q5JP01_HUMAN
Histone-binding protein RBBP7
RBBP7
285Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JNZ6Q5JNZ6_HUMAN
Histone-binding protein RBBP7
RBBP7
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JP02Q5JP02_HUMAN
Histone-binding protein RBBP7
RBBP7
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JAJ9C9JAJ9_HUMAN
Histone-binding protein RBBP7
RBBP7
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7L0C9J7L0_HUMAN
Histone-binding protein RBBP7
RBBP7
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0430161 – 6MASKEM → MAAEAGVVGAGASPDGDWRD QACGLLLHVHLSSRLGRAAP VRTGRHLRTV in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U35143 mRNA Translation: AAC50231.1
X72841 mRNA Translation: CAA51360.1
AK091911 mRNA Translation: BAG52439.1
AL929302 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14179.1 [Q16576-1]
CCDS56598.1 [Q16576-2]

Protein sequence database of the Protein Information Resource

More...PIRi		I39181

NCBI Reference Sequences

More...RefSeqi		NP_001185648.1, NM_001198719.1 [Q16576-2]
NP_002884.1, NM_002893.3 [Q16576-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000380084; ENSP00000369424; ENSG00000102054 [Q16576-2]
ENST00000380087; ENSP00000369427; ENSG00000102054 [Q16576-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5931

UCSC genome browser

More...UCSCi		uc004cxs.3, human [Q16576-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U35143 mRNA Translation: AAC50231.1
X72841 mRNA Translation: CAA51360.1
AK091911 mRNA Translation: BAG52439.1
AL929302 Genomic DNA No translation available.
CCDSiCCDS14179.1 [Q16576-1]
CCDS56598.1 [Q16576-2]
PIRiI39181
RefSeqiNP_001185648.1, NM_001198719.1 [Q16576-2]
NP_002884.1, NM_002893.3 [Q16576-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3CFSX-ray2.40B1-411[»]
3CFVX-ray2.60A/B1-411[»]
SMRiQ16576
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111866, 260 interactors
ComplexPortaliCPX-3321, SIN3A histone deacetylase complex
CPX-3322, SIN3B histone deacetylase complex
CPX-3323, SIN3A histone deacetylase complex, ES cell-specific variant
CPX-688, NuRF chromatin remodelling complex
CPX-880, MBD2/NuRD nucleosome remodeling and deacetylase complex
CPX-922, MBD3/NuRD nucleosome remodeling and deacetylase complex
CORUMiQ16576
DIPiDIP-436N
IntActiQ16576, 143 interactors
MINTiQ16576
STRINGi9606.ENSP00000369424

Chemistry databases

ChEMBLiCHEMBL3301388

PTM databases

iPTMnetiQ16576
MetOSiteiQ16576
PhosphoSitePlusiQ16576
SwissPalmiQ16576

Genetic variation databases

BioMutaiRBBP7
DMDMi2494891

Proteomic databases

EPDiQ16576
jPOSTiQ16576
MassIVEiQ16576
PaxDbiQ16576
PeptideAtlasiQ16576
PRIDEiQ16576
ProteomicsDBi60926 [Q16576-1]
60927 [Q16576-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24054, 366 antibodies

The DNASU plasmid repository

More...DNASUi		5931

Genome annotation databases

EnsembliENST00000380084; ENSP00000369424; ENSG00000102054 [Q16576-2]
ENST00000380087; ENSP00000369427; ENSG00000102054 [Q16576-1]
GeneIDi5931
KEGGihsa:5931
UCSCiuc004cxs.3, human [Q16576-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5931
DisGeNETi5931

GeneCards: human genes, protein and diseases

More...GeneCardsi		RBBP7
HGNCiHGNC:9890, RBBP7
HPAiENSG00000102054, Low tissue specificity
MIMi300825, gene
neXtProtiNX_Q16576
OpenTargetsiENSG00000102054
PharmGKBiPA34254
VEuPathDBiHostDB:ENSG00000102054.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0264, Eukaryota
GeneTreeiENSGT00940000154748
InParanoidiQ16576
OMAiPITDFNW
OrthoDBi831322at2759
PhylomeDBiQ16576
TreeFamiTF106485

Enzyme and pathway databases

PathwayCommonsiQ16576
ReactomeiR-HSA-212300, PRC2 methylates histones and DNA
R-HSA-2559580, Oxidative Stress Induced Senescence
R-HSA-3214815, HDACs deacetylate histones
R-HSA-3214841, PKMTs methylate histone lysines
R-HSA-3214847, HATs acetylate histones
R-HSA-3214858, RMTs methylate histone arginines
R-HSA-427389, ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
R-HSA-5617472, Activation of anterior HOX genes in hindbrain development during early embryogenesis
R-HSA-606279, Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-6804758, Regulation of TP53 Activity through Acetylation
R-HSA-73762, RNA Polymerase I Transcription Initiation
R-HSA-8943724, Regulation of PTEN gene transcription
R-HSA-8951664, Neddylation
R-HSA-8953750, Transcriptional Regulation by E2F6
R-HSA-9609690, HCMV Early Events
R-HSA-9679191, Potential therapeutics for SARS
SignaLinkiQ16576

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5931, 31 hits in 625 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RBBP7, human
EvolutionaryTraceiQ16576

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RBBP7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5931
PharosiQ16576, Tbio

Protein Ontology

More...PROi		PR:Q16576
RNActiQ16576, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000102054, Expressed in right adrenal gland and 242 other tissues
ExpressionAtlasiQ16576, baseline and differential
GenevisibleiQ16576, HS

Family and domain databases

DisProtiDP01282
Gene3Di2.130.10.10, 1 hit
IDEALiIID00084
InterProiView protein in InterPro
IPR020472, G-protein_beta_WD-40_rep
IPR022052, Histone-bd_RBBP4_N
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf
PfamiView protein in Pfam
PF12265, CAF1C_H4-bd, 1 hit
PF00400, WD40, 5 hits
PRINTSiPR00320, GPROTEINBRPT
SMARTiView protein in SMART
SM00320, WD40, 6 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678, WD_REPEATS_1, 3 hits
PS50082, WD_REPEATS_2, 5 hits
PS50294, WD_REPEATS_REGION, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBBP7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16576
Secondary accession number(s): Q5JP00
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: June 2, 2021
This is version 207 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again