Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-related protein A1

Gene

BCL2A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • BH domain binding Source: Ensembl
  • protein heterodimerization activity Source: GO_Central
  • protein homodimerization activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q16548

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bcl-2-related protein A1
Alternative name(s):
Bcl-2-like protein 5
Short name:
Bcl2-L-5
Hemopoietic-specific early response protein
Protein BFL-1
Protein GRS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCL2A1
Synonyms:BCL2L5, BFL1, GRS, HBPA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000140379.7

Human Gene Nomenclature Database

More...
HGNCi
HGNC:991 BCL2A1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601056 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16548

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
597

Open Targets

More...
OpenTargetsi
ENSG00000140379

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25303

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6044

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BCL2A1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2493280

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001430941 – 175Bcl-2-related protein A1Add BLAST175

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16548

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16548

PeptideAtlas

More...
PeptideAtlasi
Q16548

PRoteomics IDEntifications database

More...
PRIDEi
Q16548

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60907
60908 [Q16548-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16548

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16548

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140379 Expressed in 144 organ(s), highest expression level in bone marrow

CleanEx database of gene expression profiles

More...
CleanExi
HS_BCL2A1

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16548 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts directly with BAK1, BID, BMF and BBC3 (By similarity). Interacts directly with BCL2L11/BIM. Interacts with BAX isoform Sigma. Interacts directly with PMAIP1. Interacts with RTL10/BOP. Interacts with ING4 (By similarity).By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107069, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q16548, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000267953

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q16548

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q16548

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16548

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q16548

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi77 – 97BH1Add BLAST21
Motifi132 – 147BH2Add BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi24 – 33Ala/Pro-rich10

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4728 Eukaryota
ENOG41123S0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153262

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059278

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004840

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16548

KEGG Orthology (KO)

More...
KOi
K02162

Identification of Orthologs from Complete Genome Data

More...
OMAi
AGRKMSC

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0N5N

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16548

TreeFam database of animal gene trees

More...
TreeFami
TF315834

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.437.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR013282 Bcl2A1
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam

The PANTHER Classification System

More...
PANTHERi
PTHR11256 PTHR11256, 1 hit
PTHR11256:SF10 PTHR11256:SF10, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00452 Bcl-2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01862 BCL2FAMILY
PR01867 BCL2RLATEDA1

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56854 SSF56854, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q16548-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDCEFGYIY RLAQDYLQCV LQIPQPGSGP SKTSRVLQNV AFSVQKEVEK
60 70 80 90 100
NLKSCLDNVN VVSVDTARTL FNQVMEKEFE DGIINWGRIV TIFAFEGILI
110 120 130 140 150
KKLLRQQIAP DVDTYKEISY FVAEFIMNNT GEWIRQNGGW ENGFVKKFEP
160 170
KSGWMTFLEV TGKICEMLSL LKQYC
Length:175
Mass (Da):20,132
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i329D98AF2BE07A0D
GO
Isoform 2 (identifier: Q16548-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-175: ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC → GKWHNHTPMLVESVAHKKRKMAL

Show »
Length:163
Mass (Da):18,746
Checksum:i200ED46EECAAF317
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti72N → T in CAA70566 (PubMed:9050999).Curated1
Sequence conflicti107Q → H in CAA70566 (PubMed:9050999).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02034219C → Y1 PublicationCorresponds to variant dbSNP:rs1138357Ensembl.1
Natural variantiVAR_02034339N → K1 PublicationCorresponds to variant dbSNP:rs1138358Ensembl.1
Natural variantiVAR_02034482G → D1 PublicationCorresponds to variant dbSNP:rs3826007Ensembl.1
Natural variantiVAR_044059117E → D. Corresponds to variant dbSNP:rs34080999Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043106141 – 175ENGFV…LKQYC → GKWHNHTPMLVESVAHKKRK MAL in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U27467 mRNA Translation: AAC50288.1
U29680 mRNA Translation: AAC50438.1
Y09397 mRNA Translation: CAA70566.1
AY234180 mRNA Translation: AAO89009.1
BT007103 mRNA Translation: AAP35767.1
CR541937 mRNA Translation: CAG46735.1
CR541962 mRNA Translation: CAG46760.1
AC015871 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99129.1
BC016281 mRNA Translation: AAH16281.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10312.1 [Q16548-1]
CCDS45322.1 [Q16548-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I39055

NCBI Reference Sequences

More...
RefSeqi
NP_001108207.1, NM_001114735.1 [Q16548-2]
NP_004040.1, NM_004049.3 [Q16548-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.227817

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000267953; ENSP00000267953; ENSG00000140379 [Q16548-1]
ENST00000335661; ENSP00000335250; ENSG00000140379 [Q16548-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
597

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:597

UCSC genome browser

More...
UCSCi
uc002bfc.5 human [Q16548-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27467 mRNA Translation: AAC50288.1
U29680 mRNA Translation: AAC50438.1
Y09397 mRNA Translation: CAA70566.1
AY234180 mRNA Translation: AAO89009.1
BT007103 mRNA Translation: AAP35767.1
CR541937 mRNA Translation: CAG46735.1
CR541962 mRNA Translation: CAG46760.1
AC015871 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99129.1
BC016281 mRNA Translation: AAH16281.1
CCDSiCCDS10312.1 [Q16548-1]
CCDS45322.1 [Q16548-2]
PIRiI39055
RefSeqiNP_001108207.1, NM_001114735.1 [Q16548-2]
NP_004040.1, NM_004049.3 [Q16548-1]
UniGeneiHs.227817

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VM6X-ray2.20A1-149[»]
3I1HX-ray2.20A1-151[»]
3MQPX-ray2.24A1-151[»]
4ZEQX-ray1.80A1-151[»]
5UUKX-ray1.20A1-151[»]
5UULX-ray1.33A1-151[»]
5UUPX-ray1.73A1-151[»]
5WHHX-ray2.38A1-151[»]
5WHIX-ray1.69A1-151[»]
6E3IX-ray1.48A1-151[»]
6E3JX-ray1.48A1-151[»]
ProteinModelPortaliQ16548
SMRiQ16548
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107069, 16 interactors
IntActiQ16548, 11 interactors
STRINGi9606.ENSP00000267953

Chemistry databases

BindingDBiQ16548
ChEMBLiCHEMBL6044

PTM databases

iPTMnetiQ16548
PhosphoSitePlusiQ16548

Polymorphism and mutation databases

BioMutaiBCL2A1
DMDMi2493280

Proteomic databases

MaxQBiQ16548
PaxDbiQ16548
PeptideAtlasiQ16548
PRIDEiQ16548
ProteomicsDBi60907
60908 [Q16548-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
597
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267953; ENSP00000267953; ENSG00000140379 [Q16548-1]
ENST00000335661; ENSP00000335250; ENSG00000140379 [Q16548-2]
GeneIDi597
KEGGihsa:597
UCSCiuc002bfc.5 human [Q16548-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
597
DisGeNETi597
EuPathDBiHostDB:ENSG00000140379.7

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BCL2A1
HGNCiHGNC:991 BCL2A1
MIMi601056 gene
neXtProtiNX_Q16548
OpenTargetsiENSG00000140379
PharmGKBiPA25303

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4728 Eukaryota
ENOG41123S0 LUCA
GeneTreeiENSGT00940000153262
HOGENOMiHOG000059278
HOVERGENiHBG004840
InParanoidiQ16548
KOiK02162
OMAiAGRKMSC
OrthoDBiEOG091G0N5N
PhylomeDBiQ16548
TreeFamiTF315834

Enzyme and pathway databases

SIGNORiQ16548

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BCL2A1 human
EvolutionaryTraceiQ16548

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BCL2-related_protein_A1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
597

Protein Ontology

More...
PROi
PR:Q16548

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140379 Expressed in 144 organ(s), highest expression level in bone marrow
CleanExiHS_BCL2A1
GenevisibleiQ16548 HS

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR013282 Bcl2A1
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF10 PTHR11256:SF10, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
PR01867 BCL2RLATEDA1
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiB2LA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16548
Secondary accession number(s): Q6FGZ4
, Q6FH19, Q86W13, Q99524
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 175 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again