Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-related protein A1

Gene

BCL2A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis

Enzyme and pathway databases

SIGNORiQ16548

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-related protein A1
Alternative name(s):
Bcl-2-like protein 5
Short name:
Bcl2-L-5
Hemopoietic-specific early response protein
Protein BFL-1
Protein GRS
Gene namesi
Name:BCL2A1
Synonyms:BCL2L5, BFL1, GRS, HBPA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000140379.7
HGNCiHGNC:991 BCL2A1
MIMi601056 gene
neXtProtiNX_Q16548

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi597
OpenTargetsiENSG00000140379
PharmGKBiPA25303

Chemistry databases

ChEMBLiCHEMBL6044

Polymorphism and mutation databases

BioMutaiBCL2A1
DMDMi2493280

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001430941 – 175Bcl-2-related protein A1Add BLAST175

Proteomic databases

MaxQBiQ16548
PaxDbiQ16548
PeptideAtlasiQ16548
PRIDEiQ16548
ProteomicsDBi60907
60908 [Q16548-2]

PTM databases

iPTMnetiQ16548
PhosphoSitePlusiQ16548

Expressioni

Tissue specificityi

Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies.

Inductioni

By phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors.

Gene expression databases

BgeeiENSG00000140379 Expressed in 144 organ(s), highest expression level in bone marrow
CleanExiHS_BCL2A1
GenevisibleiQ16548 HS

Interactioni

Subunit structurei

Interacts directly with BAK1, BID, BMF and BBC3 (By similarity). Interacts directly with BCL2L11/BIM. Interacts with BAX isoform Sigma. Interacts directly with PMAIP1. Interacts with RTL10/BOP. Interacts with ING4 (By similarity).By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107069, 16 interactors
IntActiQ16548, 11 interactors
STRINGi9606.ENSP00000267953

Chemistry databases

BindingDBiQ16548

Structurei

Secondary structure

1175
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ16548
SMRiQ16548
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16548

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi77 – 97BH1Add BLAST21
Motifi132 – 147BH2Add BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi24 – 33Ala/Pro-rich10

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiKOG4728 Eukaryota
ENOG41123S0 LUCA
GeneTreeiENSGT00510000048456
HOGENOMiHOG000059278
HOVERGENiHBG004840
InParanoidiQ16548
KOiK02162
OMAiENTAEWI
OrthoDBiEOG091G0N5N
PhylomeDBiQ16548
TreeFamiTF315834

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR013282 Bcl2A1
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF10 PTHR11256:SF10, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PRINTSiPR01862 BCL2FAMILY
PR01867 BCL2RLATEDA1
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q16548-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDCEFGYIY RLAQDYLQCV LQIPQPGSGP SKTSRVLQNV AFSVQKEVEK
60 70 80 90 100
NLKSCLDNVN VVSVDTARTL FNQVMEKEFE DGIINWGRIV TIFAFEGILI
110 120 130 140 150
KKLLRQQIAP DVDTYKEISY FVAEFIMNNT GEWIRQNGGW ENGFVKKFEP
160 170
KSGWMTFLEV TGKICEMLSL LKQYC
Length:175
Mass (Da):20,132
Last modified:November 1, 1996 - v1
Checksum:i329D98AF2BE07A0D
GO
Isoform 2 (identifier: Q16548-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-175: ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC → GKWHNHTPMLVESVAHKKRKMAL

Show »
Length:163
Mass (Da):18,746
Checksum:i200ED46EECAAF317
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72N → T in CAA70566 (PubMed:9050999).Curated1
Sequence conflicti107Q → H in CAA70566 (PubMed:9050999).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02034219C → Y1 PublicationCorresponds to variant dbSNP:rs1138357Ensembl.1
Natural variantiVAR_02034339N → K1 PublicationCorresponds to variant dbSNP:rs1138358Ensembl.1
Natural variantiVAR_02034482G → D1 PublicationCorresponds to variant dbSNP:rs3826007Ensembl.1
Natural variantiVAR_044059117E → D. Corresponds to variant dbSNP:rs34080999Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043106141 – 175ENGFV…LKQYC → GKWHNHTPMLVESVAHKKRK MAL in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27467 mRNA Translation: AAC50288.1
U29680 mRNA Translation: AAC50438.1
Y09397 mRNA Translation: CAA70566.1
AY234180 mRNA Translation: AAO89009.1
BT007103 mRNA Translation: AAP35767.1
CR541937 mRNA Translation: CAG46735.1
CR541962 mRNA Translation: CAG46760.1
AC015871 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99129.1
BC016281 mRNA Translation: AAH16281.1
CCDSiCCDS10312.1 [Q16548-1]
CCDS45322.1 [Q16548-2]
PIRiI39055
RefSeqiNP_001108207.1, NM_001114735.1 [Q16548-2]
NP_004040.1, NM_004049.3 [Q16548-1]
UniGeneiHs.227817

Genome annotation databases

EnsembliENST00000267953; ENSP00000267953; ENSG00000140379 [Q16548-1]
ENST00000335661; ENSP00000335250; ENSG00000140379 [Q16548-2]
GeneIDi597
KEGGihsa:597
UCSCiuc002bfc.5 human [Q16548-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiB2LA1_HUMAN
AccessioniPrimary (citable) accession number: Q16548
Secondary accession number(s): Q6FGZ4
, Q6FH19, Q86W13, Q99524
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: September 12, 2018
This is version 173 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again