Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (16 Oct 2019)
Sequence version 2 (15 Dec 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein SSX2

Gene

SSX2

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Could act as a modulator of transcription.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein SSX2
Alternative name(s):
Cancer/testis antigen 5.2
Short name:
CT5.2
Synovial sarcoma, X breakpoint 2
Tumor antigen HOM-MEL-40
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SSX2
Synonyms:SSX2A
AND
Name:SSX2B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11336 SSX2
HGNC:22263 SSX2B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300192 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16385

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving SSX2 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei68 – 69Breakpoint for translocation to form the SSXT-SSX2 fusion protein (rare)2
Sitei110 – 111Breakpoint for translocation to form the SSXT-SSX2 fusion protein2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
6757
727837

MalaCards human disease database

More...
MalaCardsi
SSX2

Open Targets

More...
OpenTargetsi
ENSG00000241476

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
3273 Synovial sarcoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162404839

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q16385

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SSX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
3915028

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001818291 – 188Protein SSX2Add BLAST188

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei108PhosphoserineCombined sources1
Modified residuei123PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q16385

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16385

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16385

PeptideAtlas

More...
PeptideAtlasi
Q16385

PRoteomics IDEntifications database

More...
PRIDEi
Q16385

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60867 [Q16385-1]
60868 [Q16385-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16385

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16385

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000241476 Expressed in 22 organ(s), highest expression level in testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16385 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB046020
HPA045683

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts via its N-terminal region with RAB3IP and SSX2IP.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112635, 35 interactors
608281, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q16385, 24 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16385

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 83KRAB-relatedPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 80Interaction with SSX2IP1 PublicationAdd BLAST80
Regioni25 – 80Interaction with RAB3IP1 PublicationAdd BLAST56

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SSX family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JCMU Eukaryota
ENOG4111A52 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012484

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231461

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16385

KEGG Orthology (KO)

More...
KOi
K15625

Identification of Orthologs from Complete Genome Data

More...
OMAi
DNDCNCG

Database of Orthologous Groups

More...
OrthoDBi
1270676at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16385

TreeFam database of animal gene trees

More...
TreeFami
TF338517

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003655 Krueppel-associated_box-rel
IPR028804 SSX
IPR019041 SSXRD_motif

The PANTHER Classification System

More...
PANTHERi
PTHR14112 PTHR14112, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF09514 SSXRD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50806 KRAB_RELATED, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q16385-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGDDAFARR PTVGAQIPEK IQKAFDDIAK YFSKEEWEKM KASEKIFYVY
60 70 80 90 100
MKRKYEAMTK LGFKATLPPF MCNKRAEDFQ GNDLDNDPNR GNQVERPQMT
110 120 130 140 150
FGRLQGISPK IMPKKPAEEG NDSEEVPEAS GPQNDGKELC PPGKPTTSEK
160 170 180
IHERSGPKRG EHAWTHRLRE RKQLVIYEEI SDPEEDDE
Length:188
Mass (Da):21,620
Last modified:December 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBF5D18AA5F45B1B1
GO
Isoform 2 (identifier: Q16385-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     157-188: PKRGEHAWTHRLRERKQLVIYEEISDPEEDDE → NREAQEKEER...PTDCVRENSW

Note: No experimental confirmation available.
Show »
Length:223
Mass (Da):25,173
Checksum:i2BF8E1FFA4D58094
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB35674 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti169R → P in AAH07343 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_017595157 – 188PKRGE…EEDDE → NREAQEKEERRGTAHRWSSQ NTHNIGRFSLSTSMGAVHGT PKTITHNRDPKGGNMPGPTD CVRENSW in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X86175 mRNA Translation: CAA60111.1
AL445236, AL450023 Genomic DNA Translation: CAI41623.1
AL445236, AL450023 Genomic DNA Translation: CAI41624.1
BC002818 mRNA Translation: AAH02818.1
BC007343 mRNA Translation: AAH07343.1
BC016957 mRNA Translation: AAH16957.1
BC069313 mRNA Translation: AAH69313.1
BC071827 mRNA Translation: AAH71827.1
BC103863 mRNA Translation: AAI03864.1
S79332 mRNA Translation: AAB35379.1
X79200 mRNA No translation available.
S79894 mRNA Translation: AAB35674.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14344.2 [Q16385-1]
CCDS14345.2 [Q16385-2]
CCDS48129.1 [Q16385-1]
CCDS65267.1 [Q16385-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
S55058

NCBI Reference Sequences

More...
RefSeqi
NP_001157889.1, NM_001164417.2 [Q16385-1]
NP_001265626.1, NM_001278697.1
NP_001265630.1, NM_001278701.1 [Q16385-2]
NP_001265631.1, NM_001278702.1
NP_003138.3, NM_003147.5 [Q16385-2]
NP_783629.1, NM_175698.2 [Q16385-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336777; ENSP00000338796; ENSG00000241476 [Q16385-2]
ENST00000337502; ENSP00000338561; ENSG00000241476 [Q16385-1]
ENST00000596480; ENSP00000470740; ENSG00000268447 [Q16385-1]
ENST00000612490; ENSP00000477922; ENSG00000268447 [Q16385-2]
ENST00000616191; ENSP00000478714; ENSG00000268447 [Q16385-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6757
727837

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6757
hsa:727837

UCSC genome browser

More...
UCSCi
uc004dqy.3 human [Q16385-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X86175 mRNA Translation: CAA60111.1
AL445236, AL450023 Genomic DNA Translation: CAI41623.1
AL445236, AL450023 Genomic DNA Translation: CAI41624.1
BC002818 mRNA Translation: AAH02818.1
BC007343 mRNA Translation: AAH07343.1
BC016957 mRNA Translation: AAH16957.1
BC069313 mRNA Translation: AAH69313.1
BC071827 mRNA Translation: AAH71827.1
BC103863 mRNA Translation: AAI03864.1
S79332 mRNA Translation: AAB35379.1
X79200 mRNA No translation available.
S79894 mRNA Translation: AAB35674.1 Different initiation.
CCDSiCCDS14344.2 [Q16385-1]
CCDS14345.2 [Q16385-2]
CCDS48129.1 [Q16385-1]
CCDS65267.1 [Q16385-2]
PIRiS55058
RefSeqiNP_001157889.1, NM_001164417.2 [Q16385-1]
NP_001265626.1, NM_001278697.1
NP_001265630.1, NM_001278701.1 [Q16385-2]
NP_001265631.1, NM_001278702.1
NP_003138.3, NM_003147.5 [Q16385-2]
NP_783629.1, NM_175698.2 [Q16385-1]

3D structure databases

SMRiQ16385
ModBaseiSearch...

Protein-protein interaction databases

BioGridi112635, 35 interactors
608281, 3 interactors
IntActiQ16385, 24 interactors

PTM databases

iPTMnetiQ16385
PhosphoSitePlusiQ16385

Polymorphism and mutation databases

BioMutaiSSX2
DMDMi3915028

Proteomic databases

MassIVEiQ16385
MaxQBiQ16385
PaxDbiQ16385
PeptideAtlasiQ16385
PRIDEiQ16385
ProteomicsDBi60867 [Q16385-1]
60868 [Q16385-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6757

Genome annotation databases

EnsembliENST00000336777; ENSP00000338796; ENSG00000241476 [Q16385-2]
ENST00000337502; ENSP00000338561; ENSG00000241476 [Q16385-1]
ENST00000596480; ENSP00000470740; ENSG00000268447 [Q16385-1]
ENST00000612490; ENSP00000477922; ENSG00000268447 [Q16385-2]
ENST00000616191; ENSP00000478714; ENSG00000268447 [Q16385-1]
GeneIDi6757
727837
KEGGihsa:6757
hsa:727837
UCSCiuc004dqy.3 human [Q16385-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6757
727837
DisGeNETi6757
727837

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SSX2
SSX2B
HGNCiHGNC:11336 SSX2
HGNC:22263 SSX2B
HPAiCAB046020
HPA045683
MalaCardsiSSX2
MIMi300192 gene
neXtProtiNX_Q16385
OpenTargetsiENSG00000241476
Orphaneti3273 Synovial sarcoma
PharmGKBiPA162404839

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JCMU Eukaryota
ENOG4111A52 LUCA
GeneTreeiENSGT00390000012484
HOGENOMiHOG000231461
InParanoidiQ16385
KOiK15625
OMAiDNDCNCG
OrthoDBi1270676at2759
PhylomeDBiQ16385
TreeFamiTF338517

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SSX2 human
SSX2B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SSX2
PharosiQ16385

Protein Ontology

More...
PROi
PR:Q16385

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000241476 Expressed in 22 organ(s), highest expression level in testis
GenevisibleiQ16385 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003655 Krueppel-associated_box-rel
IPR028804 SSX
IPR019041 SSXRD_motif
PANTHERiPTHR14112 PTHR14112, 1 hit
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF09514 SSXRD, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SUPFAMiSSF109640 SSF109640, 1 hit
PROSITEiView protein in PROSITE
PS50806 KRAB_RELATED, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSSX2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16385
Secondary accession number(s): Q16404
, Q5JS26, Q96IP7, Q9BU88
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: December 15, 1998
Last modified: October 16, 2019
This is version 167 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again