Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (02 Dec 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Tubulin-specific chaperone E

Gene

TBCE

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tubulin-folding protein; involved in the second step of the tubulin folding pathway and in the regulation of tubulin heterodimer dissociation. Required for correct organization of microtubule cytoskeleton and mitotic splindle, and maintenance of the neuronal microtubule network.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • alpha-tubulin binding Source: GO_Central
  • chaperone binding Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q15813

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-389977, Post-chaperonin tubulin folding pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulin-specific chaperone E
Alternative name(s):
Tubulin-folding cofactor E
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TBCE
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000116957.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11582, TBCE

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604934, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15813

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hypoparathyroidism-retardation-dysmorphism syndrome (HRDS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive multisystem disorder characterized by hypoparathyroidism, intrauterine and postnatal growth retardation, psychomotor retardation, epilepsy, microcephaly, and facial dysmorphism.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03292052 – 55Missing in HRDS and KCS1. 1 Publication4
Kenny-Caffey syndrome 1 (KCS1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive form of Kenny-Caffey syndrome, a disorder characterized by impaired skeletal development with small and dense bones, short stature, and primary hypoparathyroidism with hypocalcemia. Clinical features include cortical thickening and medullary stenosis of the tubular bones, delayed closure of fontanels, defective dentition, small eyes with hypermetropia, and frontal bossing with a triangular face.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03292052 – 55Missing in HRDS and KCS1. 1 Publication4
Encephalopathy, progressive, with amyotrophy and optic atrophy (PEAMO)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive, progressive, neurodegenerative encephalopathy with onset in infancy. Affected individuals manifest delayed psychomotor development, severe hypotonia, motor regression, spinal muscular atrophy, distal amyotrophy and weakness of all limbs, and intellectual disability of variable severity. Additional features include optic atrophy, thin corpus callosum, and cerebellar atrophy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_077878155I → N in PEAMO; decreased function in the organization of microtubule cytoskeleton and mitotic splindle. 1 PublicationCorresponds to variant dbSNP:rs780472451EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Dwarfism, Mental retardation, Neurodegeneration

Organism-specific databases

DisGeNET

More...
DisGeNETi
6905

MalaCards human disease database

More...
MalaCardsi
TBCE
MIMi241410, phenotype
244460, phenotype
617207, phenotype

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
93324, Autosomal recessive Kenny-Caffey syndrome
496756, Early-onset progressive encephalopathy-spastic ataxia-distal spinal muscular atrophy syndrome
2323, Sanjad-Sakati syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36346

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q15813, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TBCE

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762146

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000835382 – 527Tubulin-specific chaperone EAdd BLAST526

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei463N6-acetyllysineCombined sources1
Modified residuei495PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15813

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15813

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q15813

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15813

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15813

PeptideAtlas

More...
PeptideAtlasi
Q15813

PRoteomics IDEntifications database

More...
PRIDEi
Q15813

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60772 [Q15813-1]
6536

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15813

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q15813

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15813

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116957, Expressed in body of pancreas and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15813, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15813, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000284770, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Supercomplex made of cofactors A to E. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation. Cofactor E binds to the cofactor D-tubulin complex; interaction with cofactor C then causes the release of tubulin polypeptides that are committed to the native state. Cofactors B and E can form a heterodimer which binds to alpha-tubulin and enhances their ability to dissociate tubulin heterodimers (By similarity).

Interacts with TBCD (PubMed:27666374).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
112768, 35 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q15813

Protein interaction database and analysis system

More...
IntActi
Q15813, 13 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000439170

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q15813, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1527
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15813

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 71CAP-GlyPROSITE-ProRule annotationAdd BLAST45
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati154 – 175LRR 1Add BLAST22
Repeati180 – 200LRR 2Add BLAST21
Repeati205 – 226LRR 3Add BLAST22
Repeati230 – 252LRR 4Add BLAST23
Repeati253 – 274LRR 5Add BLAST22
Repeati278 – 299LRR 6Add BLAST22
Repeati308 – 329LRR 7Add BLAST22
Domaini342 – 384LRRCTAdd BLAST43

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TBCE family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3207, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017716_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15813

Identification of Orthologs from Complete Genome Data

More...
OMAi
RMITVQT

Database of Orthologous Groups

More...
OrthoDBi
1596773at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15813

TreeFam database of animal gene trees

More...
TreeFami
TF313455

Family and domain databases

Conserved Domains Database

More...
CDDi
cd17044, Ubl_TBCE, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.30.190, 1 hit
3.80.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036859, CAP-Gly_dom_sf
IPR000938, CAP-Gly_domain
IPR032675, LRR_dom_sf
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf
IPR044079, Ubl_TBCE

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01302, CAP_GLY, 1 hit
PF14560, Ubiquitin_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01052, CAP_GLY, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236, SSF54236, 1 hit
SSF74924, SSF74924, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00845, CAP_GLY_1, 1 hit
PS50245, CAP_GLY_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 29 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDTLTADVI GRRVEVNGEH ATVRFAGVVP PVAGPWLGVE WDNPERGKHD
60 70 80 90 100
GSHEGTVYFK CRHPTGGSFI RPNKVNFGTD FLTAIKNRYV LEDGPEEDRK
110 120 130 140 150
EQIVTIGNKP VETIGFDSIM KQQSQLSKLQ EVSLRNCAVS CAGEKGGVAE
160 170 180 190 200
ACPNIRKVDL SKNLLSSWDE VIHIADQLRH LEVLNVSENK LKFPSGSVLT
210 220 230 240 250
GTLSVLKVLV LNQTGITWAE VLRCVAGCPG LEELYLESNN IFISERPTDV
260 270 280 290 300
LQTVKLLDLS SNQLIDENQL YLIAHLPRLE QLILSDTGIS SLHFPDAGIG
310 320 330 340 350
CKTSMFPSLK YLVVNDNQIS QWSFFNELEK LPSLRALSCL RNPLTKEDKE
360 370 380 390 400
AETARLLIIA SIGQLKTLNK CEILPEERRR AELDYRKAFG NEWKQAGGHK
410 420 430 440 450
DPEKNRLSEE FLTAHPRYQF LCLKYGAPED WELKTQQPLM LKNQLLTLKI
460 470 480 490 500
KYPHQLDQKV LEKQLPGSMT IQKVKGLLSR LLKVPVSDLL LSYESPKKPG
510 520
REIELENDLK SLQFYSVENG DCLLVRW
Length:527
Mass (Da):59,346
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC919052D2D463BA1
GO
Isoform 2 (identifier: Q15813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-220: E → EAHAQCGGSRHGLDMQKDASKFVDLCVLQKCSTSNCIISAKDHTSMRMNVAK

Show »
Length:578
Mass (Da):64,852
Checksum:i2719A81F520471CF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 29 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y809A0A2R8Y809_HUMAN
Tubulin-folding cofactor E
TBCE
311Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5Q8A0A2R8Y5Q8_HUMAN
Tubulin-folding cofactor E
TBCE
549Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7E7A0A2R8Y7E7_HUMAN
Tubulin-folding cofactor E
TBCE
487Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2U3TZJ6A0A2U3TZJ6_HUMAN
Tubulin-folding cofactor E
TBCE hCG_23762
464Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YHI9A0A2R8YHI9_HUMAN
Tubulin-folding cofactor E
TBCE
520Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4V6A0A2R8Y4V6_HUMAN
Tubulin-folding cofactor E
TBCE
252Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y784A0A2R8Y784_HUMAN
Tubulin-folding cofactor E
TBCE
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YER9A0A2R8YER9_HUMAN
Tubulin-folding cofactor E
TBCE
235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFL4A0A2R8YFL4_HUMAN
Tubulin-folding cofactor E
TBCE
370Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFM3A0A2R8YFM3_HUMAN
Tubulin-specific chaperone E
TBCE
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti450I → V in BAF84976 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03292052 – 55Missing in HRDS and KCS1. 1 Publication4
Natural variantiVAR_077878155I → N in PEAMO; decreased function in the organization of microtubule cytoskeleton and mitotic splindle. 1 PublicationCorresponds to variant dbSNP:rs780472451EnsemblClinVar.1
Natural variantiVAR_032921205V → A. Corresponds to variant dbSNP:rs16832611EnsemblClinVar.1
Natural variantiVAR_032922333S → T. Corresponds to variant dbSNP:rs35579976EnsemblClinVar.1
Natural variantiVAR_032923409E → G. Corresponds to variant dbSNP:rs16832619EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053870220E → EAHAQCGGSRHGLDMQKDAS KFVDLCVLQKCSTSNCIISA KDHTSMRMNVAK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U61232 mRNA Translation: AAB17538.1
BT007086 mRNA Translation: AAP35749.1
AK292287 mRNA Translation: BAF84976.1
AK296185 mRNA Translation: BAH12277.1
AL357556 Genomic DNA No translation available.
AL672237 Genomic DNA No translation available.
FO393422 Genomic DNA No translation available.
BC008654 mRNA Translation: AAH08654.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1605.1 [Q15813-1]
CCDS73052.1 [Q15813-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001072983.1, NM_001079515.2 [Q15813-1]
NP_001274730.1, NM_001287801.1 [Q15813-2]
NP_001274731.1, NM_001287802.1
NP_003184.1, NM_003193.4 [Q15813-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000406207; ENSP00000384571; ENSG00000284770 [Q15813-1]
ENST00000543662; ENSP00000439170; ENSG00000284770 [Q15813-2]
ENST00000634751; ENSP00000489110; ENSG00000282984 [Q15813-1]
ENST00000634780; ENSP00000488933; ENSG00000282984 [Q15813-1]
ENST00000635692; ENSP00000489157; ENSG00000282984 [Q15813-1]
ENST00000642284; ENSP00000494585; ENSG00000282984 [Q15813-1]
ENST00000642610; ENSP00000494796; ENSG00000284770 [Q15813-1]
ENST00000644604; ENSP00000495961; ENSG00000285053 [Q15813-1]
ENST00000645205; ENSP00000495823; ENSG00000285053 [Q15813-1]
ENST00000645351; ENSP00000494319; ENSG00000285053 [Q15813-1]
ENST00000645655; ENSP00000495202; ENSG00000285053 [Q15813-1]
ENST00000646624; ENSP00000494575; ENSG00000285053 [Q15813-1]
ENST00000646802; ENSP00000496170; ENSG00000282984 [Q15813-1]
ENST00000646934; ENSP00000494500; ENSG00000282984 [Q15813-1]
ENST00000647186; ENSP00000494775; ENSG00000285053 [Q15813-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6905

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6905

UCSC genome browser

More...
UCSCi
uc001hwz.2, human [Q15813-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61232 mRNA Translation: AAB17538.1
BT007086 mRNA Translation: AAP35749.1
AK292287 mRNA Translation: BAF84976.1
AK296185 mRNA Translation: BAH12277.1
AL357556 Genomic DNA No translation available.
AL672237 Genomic DNA No translation available.
FO393422 Genomic DNA No translation available.
BC008654 mRNA Translation: AAH08654.1
CCDSiCCDS1605.1 [Q15813-1]
CCDS73052.1 [Q15813-2]
RefSeqiNP_001072983.1, NM_001079515.2 [Q15813-1]
NP_001274730.1, NM_001287801.1 [Q15813-2]
NP_001274731.1, NM_001287802.1
NP_003184.1, NM_003193.4 [Q15813-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ICUX-ray2.40A/B/C/D443-527[»]
4ICVX-ray1.45A443-527[»]
SMRiQ15813
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112768, 35 interactors
CORUMiQ15813
IntActiQ15813, 13 interactors
STRINGi9606.ENSP00000439170

PTM databases

iPTMnetiQ15813
MetOSiteiQ15813
PhosphoSitePlusiQ15813

Polymorphism and mutation databases

BioMutaiTBCE
DMDMi74762146

Proteomic databases

EPDiQ15813
jPOSTiQ15813
MassIVEiQ15813
MaxQBiQ15813
PaxDbiQ15813
PeptideAtlasiQ15813
PRIDEiQ15813
ProteomicsDBi60772 [Q15813-1]
6536

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
79050, 174 antibodies
81226, 3 antibodies

The DNASU plasmid repository

More...
DNASUi
6905

Genome annotation databases

EnsembliENST00000406207; ENSP00000384571; ENSG00000284770 [Q15813-1]
ENST00000543662; ENSP00000439170; ENSG00000284770 [Q15813-2]
ENST00000634751; ENSP00000489110; ENSG00000282984 [Q15813-1]
ENST00000634780; ENSP00000488933; ENSG00000282984 [Q15813-1]
ENST00000635692; ENSP00000489157; ENSG00000282984 [Q15813-1]
ENST00000642284; ENSP00000494585; ENSG00000282984 [Q15813-1]
ENST00000642610; ENSP00000494796; ENSG00000284770 [Q15813-1]
ENST00000644604; ENSP00000495961; ENSG00000285053 [Q15813-1]
ENST00000645205; ENSP00000495823; ENSG00000285053 [Q15813-1]
ENST00000645351; ENSP00000494319; ENSG00000285053 [Q15813-1]
ENST00000645655; ENSP00000495202; ENSG00000285053 [Q15813-1]
ENST00000646624; ENSP00000494575; ENSG00000285053 [Q15813-1]
ENST00000646802; ENSP00000496170; ENSG00000282984 [Q15813-1]
ENST00000646934; ENSP00000494500; ENSG00000282984 [Q15813-1]
ENST00000647186; ENSP00000494775; ENSG00000285053 [Q15813-1]
GeneIDi6905
KEGGihsa:6905
UCSCiuc001hwz.2, human [Q15813-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6905
DisGeNETi6905
EuPathDBiHostDB:ENSG00000116957.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TBCE
HGNCiHGNC:11582, TBCE
HPAiENSG00000284770, Low tissue specificity
MalaCardsiTBCE
MIMi241410, phenotype
244460, phenotype
604934, gene
617207, phenotype
neXtProtiNX_Q15813
Orphaneti93324, Autosomal recessive Kenny-Caffey syndrome
496756, Early-onset progressive encephalopathy-spastic ataxia-distal spinal muscular atrophy syndrome
2323, Sanjad-Sakati syndrome
PharmGKBiPA36346

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3207, Eukaryota
GeneTreeiENSGT00530000063405
HOGENOMiCLU_017716_5_0_1
InParanoidiQ15813
OMAiRMITVQT
OrthoDBi1596773at2759
PhylomeDBiQ15813
TreeFamiTF313455

Enzyme and pathway databases

PathwayCommonsiQ15813
ReactomeiR-HSA-389977, Post-chaperonin tubulin folding pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
6905, 372 hits in 843 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TBCE, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TBCE

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6905
PharosiQ15813, Tbio

Protein Ontology

More...
PROi
PR:Q15813
RNActiQ15813, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116957, Expressed in body of pancreas and 242 other tissues
ExpressionAtlasiQ15813, baseline and differential
GenevisibleiQ15813, HS

Family and domain databases

CDDicd17044, Ubl_TBCE, 1 hit
Gene3Di2.30.30.190, 1 hit
3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR036859, CAP-Gly_dom_sf
IPR000938, CAP-Gly_domain
IPR032675, LRR_dom_sf
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf
IPR044079, Ubl_TBCE
PfamiView protein in Pfam
PF01302, CAP_GLY, 1 hit
PF14560, Ubiquitin_2, 1 hit
SMARTiView protein in SMART
SM01052, CAP_GLY, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
SSF74924, SSF74924, 1 hit
PROSITEiView protein in PROSITE
PS00845, CAP_GLY_1, 1 hit
PS50245, CAP_GLY_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTBCE_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15813
Secondary accession number(s): A8K8C2, B7Z3P1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: November 1, 1996
Last modified: December 2, 2020
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again