Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor coactivator 1

Gene

NCOA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3.7 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Acyltransferase, Transferase
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1368082 RORA activates gene expression
R-HSA-1368108 BMAL1:CLOCK,NPAS2 activates circadian gene expression
R-HSA-159418 Recycling of bile acids and salts
R-HSA-192105 Synthesis of bile acids and bile salts
R-HSA-193368 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-HSA-193807 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-HSA-1989781 PPARA activates gene expression
R-HSA-211976 Endogenous sterols
R-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)
R-HSA-3214847 HATs acetylate histones
R-HSA-381340 Transcriptional regulation of white adipocyte differentiation
R-HSA-3899300 SUMOylation of transcription cofactors
R-HSA-400206 Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
R-HSA-400253 Circadian Clock
R-HSA-9018519 Estrogen-dependent gene expression

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q15788

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q15788

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor coactivator 1 (EC:2.3.1.48)
Short name:
NCoA-1
Alternative name(s):
Class E basic helix-loop-helix protein 74
Short name:
bHLHe74
Protein Hin-2
RIP160
Renal carcinoma antigen NY-REN-52
Steroid receptor coactivator 1
Short name:
SRC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NCOA1
Synonyms:BHLHE74, SRC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000084676.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7668 NCOA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602691 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15788

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving NCOA1 is a cause of rhabdomyosarcoma. Translocation t(2;2)(q35;p23) with PAX3 generates the NCOA1-PAX3 oncogene consisting of the N-terminus part of PAX3 and the C-terminus part of NCOA1. The fusion protein acts as a transcriptional activator. Rhabdomyosarcoma is the most common soft tissue carcinoma in childhood, representing 5-8% of all malignancies in children.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi636 – 637LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-693; A-694; A-752 and A-753. 1 Publication2
Mutagenesisi693 – 694LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-752 and A-753. 1 Publication2
Mutagenesisi732K → R: Abolishes sumoylation; when associated with R-774. 1 Publication1
Mutagenesisi752 – 753LL → AA: Slightly affects interactions with steroid receptors. Abolishes interactions with steroid receptors; when associated with A-636; A-637; A-693 and A-694. 1 Publication2
Mutagenesisi774K → R: Abolishes sumoylation; when associated with R-732. 1 Publication1
Mutagenesisi800K → R: Does not affect sumoylation of the protein. 1 Publication1
Mutagenesisi846K → R: Does not affect sumoylation of the protein. 1 Publication1
Mutagenesisi1378K → R: Does not affect sumoylation of the protein. 1 Publication1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei867 – 868Breakpoint for translocation to form PAX3-NCOA1 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
8648

Open Targets

More...
OpenTargetsi
ENSG00000084676

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31470

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1615387

Drug and drug target database

More...
DrugBanki
DB07119 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB06875 3-(3-FLUORO-4-HYDROXYPHENYL)-7-HYDROXY-1-NAPHTHONITRILE
DB07236 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB07724 3-{5-methoxy-1-[(4-methoxyphenyl)sulfonyl]-1H-indol-3-yl}propanoic acid
DB07150 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB07198 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927 [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB08915 Aleglitazar
DB01645 Genistein
DB08231 MYRISTIC ACID

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2693

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NCOA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158518533

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000944002 – 1441Nuclear receptor coactivator 1Add BLAST1440

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei22PhosphoserineCombined sources1
Modified residuei372PhosphoserineCombined sources1 Publication1
Modified residuei395PhosphoserineCombined sources1 Publication1
Modified residuei517Phosphoserine1 Publication1
Modified residuei558PhosphoserineBy similarity1
Modified residuei569Phosphoserine1 Publication1
Modified residuei698PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki732Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linki774Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linki846Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1033Phosphoserine1 Publication1
Modified residuei1073Asymmetric dimethylarginineBy similarity1
Modified residuei1091Asymmetric dimethylarginineBy similarity1
Modified residuei1124Asymmetric dimethylarginineBy similarity1
Modified residuei1131Asymmetric dimethylarginineBy similarity1
Modified residuei1179Phosphothreonine1 Publication1
Modified residuei1185Phosphoserine1 Publication1
Modified residuei1372PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein.1 Publication
Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15788

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15788

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15788

PeptideAtlas

More...
PeptideAtlasi
Q15788

PRoteomics IDEntifications database

More...
PRIDEi
Q15788

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60761
60762 [Q15788-2]
60763 [Q15788-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15788

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15788

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000084676 Expressed in 240 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15788 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15788 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB019402
HPA070213
HPA070520

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the methyltransferase CARM1 (By similarity). Interacts with NCOA6 and NCOA2. Interacts with the FDL motif of STAT5A and STAT5B. Interacts with the LXXLL motif of STAT6. Interacts with STAT3 following IL-6 stimulation. Interacts with the basal transcription factor GTF2B. Interacts with the histone acetyltransferases EP300 and CREBBP. Interacts with PCAF, COPS5, NR3C1 and TTLL5/STAMP. Interacts with PSMB9. Interacts with UBE2L3; they functionally interact to regulate progesterone receptor transcriptional activity. Interacts with PRMT2 and DDX5. Interacts with ASXL1. Interacts with PRMT6. Interacts (via LXXLL 1, 2 and 3 motifs) with RORC (via AF-2 motif). Interacts in a ligand-dependent fashion with RXRA. Interacts with TRIP4. Interacts with NR4A3 (By similarity). Interacts with VDR.By similarity24 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114200, 114 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-711 PPARgamma-NCOA1 activated nuclear receptor complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q15788

Database of interacting proteins

More...
DIPi
DIP-30877N

Protein interaction database and analysis system

More...
IntActi
Q15788, 38 interactors

Molecular INTeraction database

More...
MINTi
Q15788

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000320940

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q15788

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11441
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15788

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15788

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15788

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 80bHLHPROSITE-ProRule annotationAdd BLAST58
Domaini109 – 180PASPROSITE-ProRule annotationAdd BLAST72

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni361 – 567Interaction with STAT31 PublicationAdd BLAST207
Regioni781 – 988Interaction with CREBBPAdd BLAST208

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi46 – 50LXXLL motif 15
Motifi112 – 116LXXLL motif 25
Motifi633 – 637LXXLL motif 35
Motifi690 – 694LXXLL motif 45
Motifi749 – 753LXXLL motif 55
Motifi913 – 917LXXLL motif 65
Motifi1435 – 1439LXXLL motif 75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi389 – 682Ser-richAdd BLAST294
Compositional biasi1053 – 1138Gln-richAdd BLAST86

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal (1107-1441) part mediates the histone acetyltransferase (HAT) activity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQ5S Eukaryota
ENOG410XPF9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063109

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052583

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15788

KEGG Orthology (KO)

More...
KOi
K09101

Identification of Orthologs from Complete Genome Data

More...
OMAi
QSMNEGP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00US

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15788

TreeFam database of animal gene trees

More...
TreeFami
TF332652

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00083 HLH, 1 hit
cd00130 PAS, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.1070, 1 hit
4.10.280.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011598 bHLH_dom
IPR010011 DUF1518
IPR036638 HLH_DNA-bd_sf
IPR028819 NCOA1
IPR009110 Nuc_rcpt_coact
IPR014920 Nuc_rcpt_coact_Ncoa-typ
IPR037077 Nuc_rcpt_coact_Ncoa_int_sf
IPR017426 Nuclear_rcpt_coactivator
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013767 PAS_fold
IPR014935 SRC/p160_LXXLL

The PANTHER Classification System

More...
PANTHERi
PTHR10684 PTHR10684, 1 hit
PTHR10684:SF1 PTHR10684:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07469 DUF1518, 2 hits
PF00010 HLH, 1 hit
PF08815 Nuc_rec_co-act, 1 hit
PF00989 PAS, 1 hit
PF08832 SRC-1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038181 Nuclear_receptor_coactivator, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01151 DUF1518, 2 hits
SM00353 HLH, 1 hit
SM00091 PAS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47459 SSF47459, 1 hit
SSF55785 SSF55785, 2 hits
SSF69125 SSF69125, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50888 BHLH, 1 hit
PS50112 PAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15788-1) [UniParc]FASTAAdd to basket
Also known as: SRC-1A, SRC1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGLGDSSSD PANPDSHKRK GSPCDTLASS TEKRRREQEN KYLEELAELL
60 70 80 90 100
SANISDIDSL SVKPDKCKIL KKTVDQIQLM KRMEQEKSTT DDDVQKSDIS
110 120 130 140 150
SSSQGVIEKE SLGPLLLEAL DGFFFVVNCE GRIVFVSENV TSYLGYNQEE
160 170 180 190 200
LMNTSVYSIL HVGDHAEFVK NLLPKSLVNG VPWPQEATRR NSHTFNCRML
210 220 230 240 250
IHPPDEPGTE NQEACQRYEV MQCFTVSQPK SIQEDGEDFQ SCLICIARRL
260 270 280 290 300
PRPPAITGVE SFMTKQDTTG KIISIDTSSL RAAGRTGWED LVRKCIYAFF
310 320 330 340 350
QPQGREPSYA RQLFQEVMTR GTASSPSYRF ILNDGTMLSA HTKCKLCYPQ
360 370 380 390 400
SPDMQPFIMG IHIIDREHSG LSPQDDTNSG MSIPRVNPSV NPSISPAHGV
410 420 430 440 450
ARSSTLPPSN SNMVSTRINR QQSSDLHSSS HSNSSNSQGS FGCSPGSQIV
460 470 480 490 500
ANVALNQGQA SSQSSNPSLN LNNSPMEGTG ISLAQFMSPR RQVTSGLATR
510 520 530 540 550
PRMPNNSFPP NISTLSSPVG MTSSACNNNN RSYSNIPVTS LQGMNEGPNN
560 570 580 590 600
SVGFSASSPV LRQMSSQNSP SRLNIQPAKA ESKDNKEIAS ILNEMIQSDN
610 620 630 640 650
SSSDGKPLDS GLLHNNDRLS DGDSKYSQTS HKLVQLLTTT AEQQLRHADI
660 670 680 690 700
DTSCKDVLSC TGTSNSASAN SSGGSCPSSH SSLTERHKIL HRLLQEGSPS
710 720 730 740 750
DITTLSVEPD KKDSASTSVS VTGQVQGNSS IKLELDASKK KESKDHQLLR
760 770 780 790 800
YLLDKDEKDL RSTPNLSLDD VKVKVEKKEQ MDPCNTNPTP MTKPTPEEIK
810 820 830 840 850
LEAQSQFTAD LDQFDQLLPT LEKAAQLPGL CETDRMDGAV TSVTIKSEIL
860 870 880 890 900
PASLQSATAR PTSRLNRLPE LELEAIDNQF GQPGTGDQIP WTNNTVTAIN
910 920 930 940 950
QSKSEDQCIS SQLDELLCPP TTVEGRNDEK ALLEQLVSFL SGKDETELAE
960 970 980 990 1000
LDRALGIDKL VQGGGLDVLS ERFPPQQATP PLIMEERPNL YSQPYSSPSP
1010 1020 1030 1040 1050
TANLPSPFQG MVRQKPSLGT MPVQVTPPRG AFSPGMGMQP RQTLNRPPAA
1060 1070 1080 1090 1100
PNQLRLQLQQ RLQGQQQLIH QNRQAILNQF AATAPVGINM RSGMQQQITP
1110 1120 1130 1140 1150
QPPLNAQMLA QRQRELYSQQ HRQRQLIQQQ RAMLMRQQSF GNNLPPSSGL
1160 1170 1180 1190 1200
PVQMGNPRLP QGAPQQFPYP PNYGTNPGTP PASTSPFSQL AANPEASLAN
1210 1220 1230 1240 1250
RNSMVSRGMT GNIGGQFGTG INPQMQQNVF QYPGAGMVPQ GEANFAPSLS
1260 1270 1280 1290 1300
PGSSMVPMPI PPPQSSLLQQ TPPASGYQSP DMKAWQQGAI GNNNVFSQAV
1310 1320 1330 1340 1350
QNQPTPAQPG VYNNMSITVS MAGGNTNVQN MNPMMAQMQM SSLQMPGMNT
1360 1370 1380 1390 1400
VCPEQINDPA LRHTGLYCNQ LSSTDLLKTE ADGTQQVQQV QVFADVQCTV
1410 1420 1430 1440
NLVGGDPYLN QPGPLGTQKP TSGPQTPQAQ QKSLLQQLLT E
Length:1,441
Mass (Da):156,757
Last modified:September 11, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i25EF6F389489121E
GO
Isoform 2 (identifier: Q15788-2) [UniParc]FASTAAdd to basket
Also known as: SRC-1E, SRC1e

The sequence of this isoform differs from the canonical sequence as follows:
     1386-1441: QVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE → DKKTEEFFSVVTTD

Note: Major form. Contains a domain at its C-terminus (1241-1399) that is able to mediate transactivation.
Show »
Length:1,399
Mass (Da):152,385
Checksum:iDACE967B31AC6B69
GO
Isoform 3 (identifier: Q15788-3) [UniParc]FASTAAdd to basket
Also known as: SRC-1 (-Q)

The sequence of this isoform differs from the canonical sequence as follows:
     1385-1385: Missing.

Show »
Length:1,440
Mass (Da):156,628
Checksum:i4E3FFED7088CDBF8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCN7B5MCN7_HUMAN
Nuclear receptor coactivator 1
NCOA1
1,248Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA64187 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAC50305 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1035Missing in AAT47737 (PubMed:15313887).Curated1
Sequence conflicti1370Q → H in AAA64187 (PubMed:11831720).Curated1
Sequence conflicti1382D → G in AAT47737 (PubMed:15313887).Curated1
Sequence conflicti1435L → R in AAB50242 (PubMed:9575154).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019768457Q → K3 PublicationsCorresponds to variant dbSNP:rs1049015Ensembl.1
Natural variantiVAR_019769466N → K3 PublicationsCorresponds to variant dbSNP:rs1049016Ensembl.1
Natural variantiVAR_019770474S → P3 PublicationsCorresponds to variant dbSNP:rs1049018Ensembl.1
Natural variantiVAR_019771591I → T3 PublicationsCorresponds to variant dbSNP:rs1049020Ensembl.1
Natural variantiVAR_019772685E → A3 PublicationsCorresponds to variant dbSNP:rs1049021Ensembl.1
Natural variantiVAR_019773794P → A1 PublicationCorresponds to variant dbSNP:rs1049025Ensembl.1
Natural variantiVAR_019774999S → F3 PublicationsCorresponds to variant dbSNP:rs1049032Ensembl.1
Natural variantiVAR_0197751154M → T3 PublicationsCorresponds to variant dbSNP:rs1049038Ensembl.1
Natural variantiVAR_0388321238V → I1 PublicationCorresponds to variant dbSNP:rs56099330Ensembl.1
Natural variantiVAR_0348821272P → S1 PublicationCorresponds to variant dbSNP:rs1804645Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0117381385Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_0117391386 – 1441QVQQV…QLLTE → DKKTEEFFSVVTTD in isoform 2. 4 PublicationsAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U59302 mRNA Translation: AAC50631.1
AJ000881 mRNA Translation: CAA04371.1
AJ000882 mRNA Translation: CAA04372.1
U90661 mRNA Translation: AAB50242.1
EF660499 Genomic DNA Translation: ABS29266.1
AC013459 Genomic DNA Translation: AAX93184.1
AC093798 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00746.1
BC111533 mRNA Translation: AAI11534.1
BC111534 mRNA Translation: AAI11535.1
U40396 mRNA Translation: AAC50305.1 Different initiation.
U19179 mRNA Translation: AAA64187.1 Different initiation.
AY633656 mRNA Translation: AAT47737.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1712.1 [Q15788-1]
CCDS1713.1 [Q15788-2]
CCDS42660.1 [Q15788-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57620
PC4363
PC4364

NCBI Reference Sequences

More...
RefSeqi
NP_003734.3, NM_003743.4 [Q15788-1]
NP_671756.1, NM_147223.2 [Q15788-2]
NP_671766.1, NM_147233.2 [Q15788-3]
XP_005264682.1, XM_005264625.1 [Q15788-1]
XP_005264683.1, XM_005264626.1 [Q15788-3]
XP_005264685.1, XM_005264628.1
XP_016860657.1, XM_017005168.1
XP_016860658.1, XM_017005169.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.596314

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288599; ENSP00000288599; ENSG00000084676 [Q15788-2]
ENST00000348332; ENSP00000320940; ENSG00000084676 [Q15788-1]
ENST00000395856; ENSP00000379197; ENSG00000084676 [Q15788-3]
ENST00000405141; ENSP00000385097; ENSG00000084676 [Q15788-2]
ENST00000406961; ENSP00000385216; ENSG00000084676 [Q15788-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8648

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8648

UCSC genome browser

More...
UCSCi
uc002rfj.4 human [Q15788-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59302 mRNA Translation: AAC50631.1
AJ000881 mRNA Translation: CAA04371.1
AJ000882 mRNA Translation: CAA04372.1
U90661 mRNA Translation: AAB50242.1
EF660499 Genomic DNA Translation: ABS29266.1
AC013459 Genomic DNA Translation: AAX93184.1
AC093798 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00746.1
BC111533 mRNA Translation: AAI11534.1
BC111534 mRNA Translation: AAI11535.1
U40396 mRNA Translation: AAC50305.1 Different initiation.
U19179 mRNA Translation: AAA64187.1 Different initiation.
AY633656 mRNA Translation: AAT47737.1
CCDSiCCDS1712.1 [Q15788-1]
CCDS1713.1 [Q15788-2]
CCDS42660.1 [Q15788-3]
PIRiA57620
PC4363
PC4364
RefSeqiNP_003734.3, NM_003743.4 [Q15788-1]
NP_671756.1, NM_147223.2 [Q15788-2]
NP_671766.1, NM_147233.2 [Q15788-3]
XP_005264682.1, XM_005264625.1 [Q15788-1]
XP_005264683.1, XM_005264626.1 [Q15788-3]
XP_005264685.1, XM_005264628.1
XP_016860657.1, XM_017005168.1
XP_016860658.1, XM_017005169.1
UniGeneiHs.596314

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FM6X-ray2.10B/E/V/Y676-700[»]
1FM9X-ray2.10B/E676-700[»]
1K4WX-ray1.90B686-700[»]
1K74X-ray2.30B/E676-700[»]
1K7LX-ray2.50B/D/F/H680-700[»]
1KV6X-ray2.70C/D686-700[»]
1N4HX-ray2.10B686-700[»]
1NQ7X-ray1.50B687-696[»]
1NRLX-ray2.00C/D676-700[»]
1P8DX-ray2.80C/D676-700[»]
1PZLX-ray2.10B687-700[»]
1RDTX-ray2.40B676-700[»]
1TFCX-ray2.40C/D686-700[»]
1U3RX-ray2.21C/D630-640[»]
1U3SX-ray2.50C/D630-640[»]
1X76X-ray2.20C/D630-640[»]
1X78X-ray2.30C/D630-640[»]
1X7BX-ray2.30C/D630-640[»]
1X7JX-ray2.30C/D630-640[»]
1XIUX-ray2.50E/F686-700[»]
1XV9X-ray2.70E/F/G/H685-697[»]
1XVPX-ray2.60E/F/G/H685-697[»]
1YY4X-ray2.70C/D630-640[»]
1YYEX-ray2.03C/D630-640[»]
1ZAFX-ray2.20C/D630-640[»]
2A3IX-ray1.95B1430-1441[»]
2C52NMR-B920-970[»]
2FVJX-ray1.99B628-640[»]
2GTKX-ray2.10B631-640[»]
2HBHX-ray2.65B686-700[»]
2HC4X-ray2.20B686-700[»]
2HCDX-ray2.60B686-700[»]
2HFPX-ray2.00B680-700[»]
2NPAX-ray2.30B/D683-697[»]
2NV7X-ray2.10C/D631-640[»]
2P54X-ray1.79B686-696[»]
2PRGX-ray2.30C623-710[»]
3BEJX-ray1.90E/F676-700[»]
3BQDX-ray2.50B1429-1441[»]
3CTBX-ray2.00A/B678-700[»]
3CWDX-ray2.40C/D685-700[»]
3DCTX-ray2.50B741-761[»]
3DCUX-ray2.95B741-761[»]
3DR1X-ray2.70B686-700[»]
3ET1X-ray2.50P/Q681-696[»]
3ET3X-ray1.95P680-695[»]
3FEIX-ray2.40Z744-756[»]
3FEJX-ray2.01B628-640[»]
3FURX-ray2.30H629-640[»]
3FXVX-ray2.26B744-756[»]
3G8IX-ray2.20Z744-756[»]
3G9EX-ray2.30B628-640[»]
3GYTX-ray2.40B1429-1441[»]
3GYUX-ray2.40B1429-1441[»]
3H0AX-ray2.10B/E629-640[»]
3HC5X-ray2.60B741-761[»]
3HC6X-ray3.20B741-761[»]
3HVLX-ray2.10A/B678-700[»]
3IPQX-ray2.00B676-700[»]
3IPSX-ray2.26C/D676-700[»]
3IPUX-ray2.40C/D676-700[»]
3KMRX-ray1.80C686-698[»]
3LMPX-ray1.90C686-700[»]
3OKHX-ray2.50B744-757[»]
3OKIX-ray2.00B/D744-757[»]
3OLFX-ray1.90B/D744-757[»]
3OLLX-ray1.50C/D683-701[»]
3OLSX-ray2.20C/D683-701[»]
3OMKX-ray1.90B/D744-757[»]
3OMMX-ray2.10B/D744-757[»]
3OMOX-ray2.21C/D683-701[»]
3OMPX-ray2.05C/D683-701[»]
3OMQX-ray1.97C/D683-701[»]
3OOFX-ray2.29B/D744-757[»]
3OOKX-ray2.29B/D744-757[»]
3P88X-ray2.95B745-755[»]
3P89X-ray2.30B745-755[»]
3QT0X-ray2.50C685-700[»]
3RUTX-ray3.00B745-755[»]
3RUUX-ray2.50B745-755[»]
3RVFX-ray3.10B741-761[»]
3S9SX-ray2.55B685-697[»]
3T03X-ray2.10C/D683-700[»]
3UU7X-ray2.20F/G686-698[»]
3UUAX-ray2.05F/G686-698[»]
3UUDX-ray1.60C/D686-698[»]
3V9YX-ray2.10B686-700[»]
3VN2X-ray2.18C685-700[»]
4DK7X-ray2.45B/D745-756[»]
4DK8X-ray2.75B/D745-756[»]
4DM6X-ray1.90E/F676-700[»]
4DM8X-ray2.30C/D676-700[»]
4DQMX-ray2.75B/D1432-1441[»]
4F9MX-ray1.90C686-700[»]
4FGYX-ray2.84B686-696[»]
4G1DX-ray2.90B686-700[»]
4G1YX-ray2.85B686-700[»]
4G1ZX-ray2.50B686-700[»]
4G20X-ray2.90B686-700[»]
4G21X-ray2.90B686-700[»]
4G2HX-ray2.50B686-700[»]
4HEEX-ray2.50Y676-700[»]
4J5XX-ray2.80A/B/C/D678-700[»]
4JYGX-ray2.35F/G686-698[»]
4JYHX-ray2.60C/G686-698[»]
4JYIX-ray1.90F/G686-698[»]
4MG5X-ray2.05C/D686-698[»]
4MG6X-ray2.10C/D686-698[»]
4MG7X-ray2.15C/D686-698[»]
4MG8X-ray1.85C/D686-698[»]
4MG9X-ray2.00F/G686-698[»]
4MGAX-ray1.80C/D686-698[»]
4MGBX-ray1.85C/D686-698[»]
4MGCX-ray2.15F/G686-698[»]
4MGDX-ray1.90F/G686-698[»]
4RUJX-ray2.35B686-700[»]
4RUPX-ray2.75B686-700[»]
4TUZX-ray1.90F/G686-698[»]
4TV1X-ray1.85C/D686-698[»]
4UDAX-ray2.03B1427-1441[»]
4UDBX-ray2.36B1427-1441[»]
4Y29X-ray1.98B1432-1441[»]
5A86X-ray2.25C/D682-698[»]
5AVIX-ray2.70B/D676-700[»]
5AVLX-ray2.80B676-700[»]
5AZTX-ray3.45C683-697[»]
5DSHX-ray2.95B685-700[»]
5DV3X-ray2.75B685-700[»]
5DV6X-ray2.80B685-700[»]
5DV8X-ray2.75B685-700[»]
5DVCX-ray2.30B685-700[»]
5DWLX-ray2.20B685-700[»]
5E7VX-ray2.40B686-700[»]
5GTNX-ray1.85B685-700[»]
5GTOX-ray2.10B685-700[»]
5GTPX-ray2.35B685-700[»]
5HJSX-ray1.72C/D676-700[»]
5JI0X-ray1.98E/F676-700[»]
5JMMX-ray2.10F/G686-698[»]
5L7EX-ray1.86B1432-1441[»]
5L7GX-ray2.01B1432-1441[»]
5L7HX-ray1.84B1432-1441[»]
5MWPX-ray1.82B1427-1441[»]
5MWYX-ray1.75B1427-1441[»]
5MX7X-ray1.98B1686-700[»]
5NKYX-ray2.10B686-700[»]
5NMAX-ray2.80B686-700[»]
5NMBX-ray2.50B2686-700[»]
5NWMNMR-A257-385[»]
5OW7X-ray2.10B686-700[»]
5OW9X-ray2.40B686-700[»]
5OWDX-ray2.15B686-700[»]
5Q0JX-ray2.00B/D744-757[»]
5Q0KX-ray1.80B744-757[»]
5Q0LX-ray2.50B/D744-757[»]
5Q0MX-ray2.20B744-757[»]
5Q0NX-ray2.40B/D744-757[»]
5Q0OX-ray1.90B/D744-757[»]
5Q0PX-ray1.80B/D744-757[»]
5Q0QX-ray2.60B/D744-757[»]
5Q0RX-ray1.91B744-757[»]
5Q0SX-ray2.50B/D744-757[»]
5Q0TX-ray2.14B744-757[»]
5Q0UX-ray1.90B/D744-757[»]
5Q0VX-ray1.87B/D744-757[»]
5Q0WX-ray1.90B744-757[»]
5Q0XX-ray2.26B744-757[»]
5Q0YX-ray2.20B/D744-757[»]
5Q0ZX-ray2.26B/D744-757[»]
5Q10X-ray2.20B744-757[»]
5Q11X-ray2.20B744-757[»]
5Q12X-ray2.00B744-757[»]
5Q13X-ray1.90B/D744-757[»]
5Q14X-ray1.85B/D744-757[»]
5Q15X-ray1.90B/D744-757[»]
5Q16X-ray2.00B/D744-757[»]
5Q18X-ray1.90B/D744-757[»]
5Q19X-ray1.98B/D744-757[»]
5Q1AX-ray2.00B/D744-757[»]
5Q1BX-ray2.30B/D744-757[»]
5Q1CX-ray2.30B/D744-757[»]
5Q1DX-ray1.89B/D744-757[»]
5Q1EX-ray1.85B744-757[»]
5Q1FX-ray2.30B/D744-757[»]
5Q1GX-ray2.00B744-757[»]
5Q1HX-ray2.20B/D/F/H744-757[»]
5Q1IX-ray1.95B744-757[»]
5X0RX-ray2.67C/D676-700[»]
5X8UX-ray2.00B686-700[»]
5X8WX-ray2.30B686-700[»]
5YCNX-ray2.15B685-700[»]
5YCPX-ray2.00B685-700[»]
5YP6X-ray2.20B688-695[»]
6BNSX-ray2.56A/B678-710[»]
6FO7X-ray2.59B686-700[»]
6FO8X-ray2.30B686-700[»]
6FO9X-ray2.70B686-700[»]
6FOBX-ray2.75B686-700[»]
6FODX-ray2.50B686-700[»]
ProteinModelPortaliQ15788
SMRiQ15788
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114200, 114 interactors
ComplexPortaliCPX-711 PPARgamma-NCOA1 activated nuclear receptor complex
CORUMiQ15788
DIPiDIP-30877N
IntActiQ15788, 38 interactors
MINTiQ15788
STRINGi9606.ENSP00000320940

Chemistry databases

BindingDBiQ15788
ChEMBLiCHEMBL1615387
DrugBankiDB07119 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL
DB06875 3-(3-FLUORO-4-HYDROXYPHENYL)-7-HYDROXY-1-NAPHTHONITRILE
DB07236 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL
DB07230 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE
DB07724 3-{5-methoxy-1-[(4-methoxyphenyl)sulfonyl]-1H-indol-3-yl}propanoic acid
DB07150 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME
DB07198 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE
DB06927 [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE
DB08915 Aleglitazar
DB01645 Genistein
DB08231 MYRISTIC ACID
GuidetoPHARMACOLOGYi2693

PTM databases

iPTMnetiQ15788
PhosphoSitePlusiQ15788

Polymorphism and mutation databases

BioMutaiNCOA1
DMDMi158518533

Proteomic databases

EPDiQ15788
MaxQBiQ15788
PaxDbiQ15788
PeptideAtlasiQ15788
PRIDEiQ15788
ProteomicsDBi60761
60762 [Q15788-2]
60763 [Q15788-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288599; ENSP00000288599; ENSG00000084676 [Q15788-2]
ENST00000348332; ENSP00000320940; ENSG00000084676 [Q15788-1]
ENST00000395856; ENSP00000379197; ENSG00000084676 [Q15788-3]
ENST00000405141; ENSP00000385097; ENSG00000084676 [Q15788-2]
ENST00000406961; ENSP00000385216; ENSG00000084676 [Q15788-1]
GeneIDi8648
KEGGihsa:8648
UCSCiuc002rfj.4 human [Q15788-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8648
DisGeNETi8648
EuPathDBiHostDB:ENSG00000084676.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NCOA1
HGNCiHGNC:7668 NCOA1
HPAiCAB019402
HPA070213
HPA070520
MIMi602691 gene
neXtProtiNX_Q15788
OpenTargetsiENSG00000084676
PharmGKBiPA31470

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IQ5S Eukaryota
ENOG410XPF9 LUCA
GeneTreeiENSGT00530000063109
HOVERGENiHBG052583
InParanoidiQ15788
KOiK09101
OMAiQSMNEGP
OrthoDBiEOG091G00US
PhylomeDBiQ15788
TreeFamiTF332652

Enzyme and pathway databases

ReactomeiR-HSA-1368082 RORA activates gene expression
R-HSA-1368108 BMAL1:CLOCK,NPAS2 activates circadian gene expression
R-HSA-159418 Recycling of bile acids and salts
R-HSA-192105 Synthesis of bile acids and bile salts
R-HSA-193368 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-HSA-193807 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-HSA-1989781 PPARA activates gene expression
R-HSA-211976 Endogenous sterols
R-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-2426168 Activation of gene expression by SREBF (SREBP)
R-HSA-3214847 HATs acetylate histones
R-HSA-381340 Transcriptional regulation of white adipocyte differentiation
R-HSA-3899300 SUMOylation of transcription cofactors
R-HSA-400206 Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
R-HSA-400253 Circadian Clock
R-HSA-9018519 Estrogen-dependent gene expression
SignaLinkiQ15788
SIGNORiQ15788

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NCOA1 human
EvolutionaryTraceiQ15788

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Nuclear_receptor_coactivator_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8648

Protein Ontology

More...
PROi
PR:Q15788

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000084676 Expressed in 240 organ(s), highest expression level in forebrain
ExpressionAtlasiQ15788 baseline and differential
GenevisibleiQ15788 HS

Family and domain databases

CDDicd00083 HLH, 1 hit
cd00130 PAS, 1 hit
Gene3Di1.10.287.1070, 1 hit
4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR010011 DUF1518
IPR036638 HLH_DNA-bd_sf
IPR028819 NCOA1
IPR009110 Nuc_rcpt_coact
IPR014920 Nuc_rcpt_coact_Ncoa-typ
IPR037077 Nuc_rcpt_coact_Ncoa_int_sf
IPR017426 Nuclear_rcpt_coactivator
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013767 PAS_fold
IPR014935 SRC/p160_LXXLL
PANTHERiPTHR10684 PTHR10684, 1 hit
PTHR10684:SF1 PTHR10684:SF1, 1 hit
PfamiView protein in Pfam
PF07469 DUF1518, 2 hits
PF00010 HLH, 1 hit
PF08815 Nuc_rec_co-act, 1 hit
PF00989 PAS, 1 hit
PF08832 SRC-1, 1 hit
PIRSFiPIRSF038181 Nuclear_receptor_coactivator, 1 hit
SMARTiView protein in SMART
SM01151 DUF1518, 2 hits
SM00353 HLH, 1 hit
SM00091 PAS, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
SSF55785 SSF55785, 2 hits
SSF69125 SSF69125, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
PS50112 PAS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCOA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15788
Secondary accession number(s): O00150
, O43792, O43793, Q13071, Q13420, Q2T9G5, Q53SX3, Q6GVI5, Q7KYV3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: September 11, 2007
Last modified: December 5, 2018
This is version 181 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again