Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (22 Apr 2020)
Sequence version 4 (16 Dec 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Striated muscle preferentially expressed protein kinase

Gene

SPEG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Miscellaneous

Expression is under the tight control of the locus control region (LCRs).

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei1630ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1719Proton acceptorBy similarity1
Binding sitei2995ATPPROSITE-ProRule annotation1
Active sitei3085Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi1607 – 1615ATPPROSITE-ProRule annotation9
Nucleotide bindingi2972 – 2980ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processDifferentiation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q15772

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Striated muscle preferentially expressed protein kinase (EC:2.7.11.1)
Alternative name(s):
Aortic preferentially expressed protein 1
Short name:
APEG-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPEG
Synonyms:APEG1, KIAA1297
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16901 SPEG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615950 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15772

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Myopathy, centronuclear, 5 (CNM5)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of centronuclear myopathy, a congenital muscle disorder characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers. CNM5 features include severe neonatal hypotonia with respiratory insufficiency, difficulty feeding, and delayed motor development. Some patients die in infancy, and some develop dilated cardiomyopathy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0718082757G → V in CNM5. 1 PublicationCorresponds to variant dbSNP:rs587777676EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10290

MalaCards human disease database

More...
MalaCardsi
SPEG
MIMi615959 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000072195

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
169186 Autosomal recessive centronuclear myopathy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672598

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q15772 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPEG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218512143

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000726661 – 3267Striated muscle preferentially expressed protein kinaseAdd BLAST3267

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei139PhosphoserineBy similarity1
Modified residuei364PhosphoserineBy similarity1
Modified residuei371PhosphoserineBy similarity1
Modified residuei375PhosphothreonineBy similarity1
Modified residuei378PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei419PhosphoserineBy similarity1
Modified residuei449PhosphothreonineBy similarity1
Modified residuei453PhosphoserineBy similarity1
Modified residuei488PhosphoserineCombined sources1
Modified residuei506PhosphoserineBy similarity1
Modified residuei526PhosphoserineBy similarity1
Modified residuei549PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi989 ↔ 1041PROSITE-ProRule annotation
Modified residuei1128PhosphoserineBy similarity1
Modified residuei1172PhosphoserineBy similarity1
Modified residuei1988PhosphoserineBy similarity1
Modified residuei2014PhosphoserineBy similarity1
Modified residuei2015PhosphoserineBy similarity1
Modified residuei2037PhosphoserineBy similarity1
Modified residuei2055Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei2055Omega-N-methylarginine; alternateBy similarity1
Modified residuei2109PhosphoserineBy similarity1
Modified residuei2130PhosphoserineBy similarity1
Modified residuei2139Omega-N-methylarginineBy similarity1
Modified residuei2177PhosphoserineBy similarity1
Modified residuei2376PhosphoserineBy similarity1
Modified residuei2380PhosphothreonineBy similarity1
Modified residuei2410PhosphoserineBy similarity1
Modified residuei2414PhosphoserineBy similarity1
Modified residuei2438PhosphoserineBy similarity1
Modified residuei2439PhosphoserineBy similarity1
Modified residuei2444PhosphoserineBy similarity1
Modified residuei2448PhosphoserineBy similarity1
Modified residuei2521PhosphoserineBy similarity1
Modified residuei2524PhosphoserineBy similarity1
Modified residuei2559PhosphoserineBy similarity1
Disulfide bondi2605 ↔ 2657PROSITE-ProRule annotation
Modified residuei2771PhosphothreonineBy similarity1
Modified residuei2774PhosphoserineBy similarity1
Modified residuei2949PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

May be autophosphorylated.

Keywords - PTMi

Disulfide bond, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15772

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15772

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q15772

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15772

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15772

PeptideAtlas

More...
PeptideAtlasi
Q15772

PRoteomics IDEntifications database

More...
PRIDEi
Q15772

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60751 [Q15772-5]
60752 [Q15772-1]
60753 [Q15772-3]
60754 [Q15772-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15772

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15772

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 3 is quickly down-regulated in response to vascular injury, when ASMC cells change from a quiescent to a proliferative phenotype.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072195 Expressed in esophagus and 198 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15772 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15772 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000072195 Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MTM1. Isoform 3 is found as a monomer or homodimer.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115579, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q15772, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000311684

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q15772 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

13267
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15772

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15772

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini43 – 124Ig-like 1Add BLAST82
Domaini722 – 810Ig-like 2Add BLAST89
Domaini869 – 958Ig-like 3Add BLAST90
Domaini963 – 1057Ig-like 4Add BLAST95
Domaini1064 – 1152Ig-like 5Add BLAST89
Domaini1188 – 1278Ig-like 6Add BLAST91
Domaini1285 – 1382Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST98
Domaini1384 – 1480Ig-like 7Add BLAST97
Domaini1485 – 1573Ig-like 8Add BLAST89
Domaini1601 – 1854Protein kinase 1PROSITE-ProRule annotationAdd BLAST254
Domaini2583 – 2673Ig-like 9Add BLAST91
Domaini2680 – 2774Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST95
Domaini2966 – 3218Protein kinase 2PROSITE-ProRule annotationAdd BLAST253

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi284 – 345Pro-richAdd BLAST62
Compositional biasi525 – 634Pro-richAdd BLAST110
Compositional biasi1919 – 1924Poly-Ser6
Compositional biasi1925 – 1931Poly-Glu7
Compositional biasi2175 – 2316Pro-richAdd BLAST142
Compositional biasi2339 – 2503Arg-richAdd BLAST165
Compositional biasi2786 – 2965Pro-richAdd BLAST180

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0032 Eukaryota
KOG0613 Eukaryota
ENOG410XQFD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161126

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000381_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15772

KEGG Orthology (KO)

More...
KOi
K08809

Identification of Orthologs from Complete Genome Data

More...
OMAi
RLQHDCI

Database of Orthologous Groups

More...
OrthoDBi
7796at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15772

TreeFam database of animal gene trees

More...
TreeFami
TF331962

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 11 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR015726 Ser/Thr_kin_striated-sp
IPR008271 Ser/Thr_kinase_AS

The PANTHER Classification System

More...
PANTHERi
PTHR47633:SF3 PTHR47633:SF3, 5 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 9 hits
PF00069 Pkinase, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 9 hits
SM00408 IGc2, 9 hits
SM00220 S_TKc, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 9 hits
SSF49265 SSF49265, 1 hit
SSF56112 SSF56112, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 8 hits
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 2 hits
PS00108 PROTEIN_KINASE_ST, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 4 (identifier: Q15772-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQKARGTRGE DAGTRAPPSP GVPPKRAKVG AGGGAPVAVA GAPVFLRPLK
60 70 80 90 100
NAAVCAGSDV RLRVVVSGTP QPSLRWFRDG QLLPAPAPEP SCLWLRRCGA
110 120 130 140 150
QDAGVYSCMA QNERGRASCE AVLTVLEVGD SETAEDDISD VQGTQRLELR
160 170 180 190 200
DDGAFSTPTG GSDTLVGTSL DTPPTSVTGT SEEQVSWWGS GQTVLEQEAG
210 220 230 240 250
SGGGTRRLPG SPRQAQATGA GPRHLGVEPL VRASRANLVG ASWGSEDSLS
260 270 280 290 300
VASDLYGSAF SLYRGRALSI HVSVPQSGLR REEPDLQPQL ASEAPRRPAQ
310 320 330 340 350
PPPSKSALLP PPSPRVGKRS PPGPPAQPAA TPTSPHRRTQ EPVLPEDTTT
360 370 380 390 400
EEKRGKKSKS SGPSLAGTAE SRPQTPLSEA SGRLSALGRS PRLVRAGSRI
410 420 430 440 450
LDKLQFFEER RRSLERSDSP PAPLRPWVPL RKARSLEQPK SERGAPWGTP
460 470 480 490 500
GASQEELRAP GSVAERRRLF QQKAASLDER TRQRSPASDL ELRFAQELGR
510 520 530 540 550
IRRSTSREEL VRSHESLRAT LQRAPSPREP GEPPLFSRPS TPKTSRAVSP
560 570 580 590 600
AAAQPPSPSS AEKPGDEPGR PRSRGPAGRT EPGEGPQQEV RRRDQFPLTR
610 620 630 640 650
SRAIQECRSP VPPPAADPPE ARTKAPPGRK REPPAQAVRF LPWATPGLEG
660 670 680 690 700
AAVPQTLEKN RAGPEAEKRL RRGPEEDGPW GPWDRRGARS QGKGRRARPT
710 720 730 740 750
SPELESSDDS YVSAGEEPLE APVFEIPLQN VVVAPGADVL LKCIITANPP
760 770 780 790 800
PQVSWHKDGS ALRSEGRLLL RAEGERHTLL LREARAADAG SYMATATNEL
810 820 830 840 850
GQATCAASLT VRPGGSTSPF SSPITSDEEY LSPPEEFPEP GETWPRTPTM
860 870 880 890 900
KPSPSQNRRS SDTGSKAPPT FKVSLMDQSV REGQDVIMSI RVQGEPKPVV
910 920 930 940 950
SWLRNRQPVR PDQRRFAEEA EGGLCRLRIL AAERGDAGFY TCKAVNEYGA
960 970 980 990 1000
RQCEARLEVR AHPESRSLAV LAPLQDVDVG AGEMALFECL VAGPTDVEVD
1010 1020 1030 1040 1050
WLCRGRLLQP ALLKCKMHFD GRKCKLLLTS VHEDDSGVYT CKLSTAKDEL
1060 1070 1080 1090 1100
TCSARLTVRP SLAPLFTRLL EDVEVLEGRA ARFDCKISGT PPPVVTWTHF
1110 1120 1130 1140 1150
GCPMEESENL RLRQDGGLHS LHIAHVGSED EGLYAVSAVN THGQAHCSAQ
1160 1170 1180 1190 1200
LYVEEPRTAA SGPSSKLEKM PSIPEEPEQG ELERLSIPDF LRPLQDLEVG
1210 1220 1230 1240 1250
LAKEAMLECQ VTGLPYPTIS WFHNGHRIQS SDDRRMTQYR DVHRLVFPAV
1260 1270 1280 1290 1300
GPQHAGVYKS VIANKLGKAA CYAHLYVTDV VPGPPDGAPQ VVAVTGRMVT
1310 1320 1330 1340 1350
LTWNPPRSLD MAIDPDSLTY TVQHQVLGSD QWTALVTGLR EPGWAATGLR
1360 1370 1380 1390 1400
KGVQHIFRVL STTVKSSSKP SPPSEPVQLL EHGPTLEEAP AMLDKPDIVY
1410 1420 1430 1440 1450
VVEGQPASVT VTFNHVEAQV VWRSCRGALL EARAGVYELS QPDDDQYCLR
1460 1470 1480 1490 1500
ICRVSRRDMG ALTCTARNRH GTQTCSVTLE LAEAPRFESI MEDVEVGAGE
1510 1520 1530 1540 1550
TARFAVVVEG KPLPDIMWYK DEVLLTESSH VSFVYEENEC SLVVLSTGAQ
1560 1570 1580 1590 1600
DGGVYTCTAQ NLAGEVSCKA ELAVHSAQTA MEVEGVGEDE DHRGRRLSDF
1610 1620 1630 1640 1650
YDIHQEIGRG AFSYLRRIVE RSSGLEFAAK FIPSQAKPKA SARREARLLA
1660 1670 1680 1690 1700
RLQHDCVLYF HEAFERRRGL VIVTELCTEE LLERIARKPT VCESEIRAYM
1710 1720 1730 1740 1750
RQVLEGIHYL HQSHVLHLDV KPENLLVWDG AAGEQQVRIC DFGNAQELTP
1760 1770 1780 1790 1800
GEPQYCQYGT PEFVAPEIVN QSPVSGVTDI WPVGVVAFLC LTGISPFVGE
1810 1820 1830 1840 1850
NDRTTLMNIR NYNVAFEETT FLSLSREARG FLIKVLVQDR LRPTAEETLE
1860 1870 1880 1890 1900
HPWFKTQAKG AEVSTDHLKL FLSRRRWQRS QISYKCHLVL RPIPELLRAP
1910 1920 1930 1940 1950
PERVWVTMPR RPPPSGGLSS SSDSEEEELE ELPSVPRPLQ PEFSGSRVSL
1960 1970 1980 1990 2000
TDIPTEDEAL GTPETGAATP MDWQEQGRAP SQDQEAPSPE ALPSPGQEPA
2010 2020 2030 2040 2050
AGASPRRGEL RRGSSAESAL PRAGPRELGR GLHKAASVEL PQRRSPSPGA
2060 2070 2080 2090 2100
TRLARGGLGE GEYAQRLQAL RQRLLRGGPE DGKVSGLRGP LLESLGGRAR
2110 2120 2130 2140 2150
DPRMARAASS EAAPHHQPPL ENRGLQKSSS FSQGEAEPRG RHRRAGAPLE
2160 2170 2180 2190 2200
IPVARLGARR LQESPSLSAL SEAQPSSPAR PSAPKPSTPK SAEPSATTPS
2210 2220 2230 2240 2250
DAPQPPAPQP AQDKAPEPRP EPVRASKPAP PPQALQTLAL PLTPYAQIIQ
2260 2270 2280 2290 2300
SLQLSGHAQG PSQGPAAPPS EPKPHAAVFA RVASPPPGAP EKRVPSAGGP
2310 2320 2330 2340 2350
PVLAEKARVP TVPPRPGSSL SSSIENLESE AVFEAKFKRS RESPLSLGLR
2360 2370 2380 2390 2400
LLSRSRSEER GPFRGAEEED GIYRPSPAGT PLELVRRPER SRSVQDLRAV
2410 2420 2430 2440 2450
GEPGLVRRLS LSLSQRLRRT PPAQRHPAWE ARGGDGESSE GGSSARGSPV
2460 2470 2480 2490 2500
LAMRRRLSFT LERLSSRLQR SGSSEDSGGA SGRSTPLFGR LRRATSEGES
2510 2520 2530 2540 2550
LRRLGLPHNQ LAAQAGATTP SAESLGSEAS ATSGSSAPGE SRSRLRWGFS
2560 2570 2580 2590 2600
RPRKDKGLSP PNLSASVQEE LGHQYVRSES DFPPVFHIKL KDQVLLEGEA
2610 2620 2630 2640 2650
ATLLCLPAAC PAPHISWMKD KKSLRSEPSV IIVSCKDGRQ LLSIPRAGKR
2660 2670 2680 2690 2700
HAGLYECSAT NVLGSITSSC TVAVARVPGK LAPPEVPQTY QDTALVLWKP
2710 2720 2730 2740 2750
GDSRAPCTYT LERRVDGESV WHPVSSGIPD CYYNVTHLPV GVTVRFRVAC
2760 2770 2780 2790 2800
ANRAGQGPFS NSSEKVFVRG TQDSSAVPSA AHQEAPVTSR PARARPPDSP
2810 2820 2830 2840 2850
TSLAPPLAPA APTPPSVTVS PSSPPTPPSQ ALSSLKAVGP PPQTPPRRHR
2860 2870 2880 2890 2900
GLQAARPAEP TLPSTHVTPS EPKPFVLDTG TPIPASTPQG VKPVSSSTPV
2910 2920 2930 2940 2950
YVVTSFVSAP PAPEPPAPEP PPEPTKVTVQ SLSPAKEVVS SPGSSPRSSP
2960 2970 2980 2990 3000
RPEGTTLRQG PPQKPYTFLE EKARGRFGVV RACRENATGR TFVAKIVPYA
3010 3020 3030 3040 3050
AEGKRRVLQE YEVLRTLHHE RIMSLHEAYI TPRYLVLIAE SCGNRELLCG
3060 3070 3080 3090 3100
LSDRFRYSED DVATYMVQLL QGLDYLHGHH VLHLDIKPDN LLLAPDNALK
3110 3120 3130 3140 3150
IVDFGSAQPY NPQALRPLGH RTGTLEFMAP EMVKGEPIGS ATDIWGAGVL
3160 3170 3180 3190 3200
TYIMLSGRSP FYEPDPQETE ARIVGGRFDA FQLYPNTSQS ATLFLRKVLS
3210 3220 3230 3240 3250
VHPWSRPSLQ DCLAHPWLQD AYLMKLRRQT LTFTTNRLKE FLGEQRRRRA
3260
EAATRHKVLL RSYPGGP
Length:3,267
Mass (Da):354,289
Last modified:December 16, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE67BEB5624144233
GO
Isoform 2 (identifier: Q15772-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-792: Missing.
     961-962: AH → GE
     963-3267: Missing.

Show »
Length:170
Mass (Da):18,673
Checksum:i275949922564F798
GO
Isoform 3 (identifier: Q15772-4) [UniParc]FASTAAdd to basket
Also known as: APEG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-849: Missing.
     961-962: AH → GE
     963-3267: Missing.

Note: Produced by alternative promoter usage.Curated
Show »
Length:113
Mass (Da):12,692
Checksum:i04F367263A1397C5
GO
Isoform 1 (identifier: Q15772-1) [UniParc]FASTAAdd to basket
Also known as: SPEG

The sequence of this isoform differs from the canonical sequence as follows:
     3209-3267: LQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQRRRRAEAATRHKVLLRSYPGGP → SCLSVCHKEIKMASS

Note: Produced by alternative splicing.Curated
Show »
Length:3,223
Mass (Da):348,903
Checksum:iFBF1188F9F1B883A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9ZVR7B9ZVR7_HUMAN
Striated muscle preferentially-expr...
SPEG
858Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8D8C9J8D8_HUMAN
Striated muscle preferentially-expr...
SPEG
299Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWU5C9JWU5_HUMAN
Striated muscle preferentially-expr...
SPEG
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Y5H7C3Y5_HUMAN
Striated muscle preferentially-expr...
SPEG
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y3W0H0Y3W0_HUMAN
Striated muscle preferentially-expr...
SPEG
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E9J7G5E9J7_HUMAN
Aortic preferentially expressed gen...
SPEG APEG1, hCG_2012857
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCA7F8WCA7_HUMAN
Striated muscle preferentially-expr...
SPEG
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAY15052 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence ABD61734 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti71Q → H in ABD61734 (PubMed:16545539).Curated1
Sequence conflicti73S → I in ABD61734 (PubMed:16545539).Curated1
Sequence conflicti2047S → G in AAT80901 (PubMed:15185077).Curated1
Sequence conflicti2047S → G in BAA92535 (PubMed:10718198).Curated1
Sequence conflicti3005R → P in AAT80901 (PubMed:15185077).Curated1
Sequence conflicti3005R → P in BAA92535 (PubMed:10718198).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_041101206R → H1 PublicationCorresponds to variant dbSNP:rs55821435Ensembl.1
Natural variantiVAR_041102934R → C1 PublicationCorresponds to variant dbSNP:rs34398769Ensembl.1
Natural variantiVAR_041103966R → Q1 PublicationCorresponds to variant dbSNP:rs34861443Ensembl.1
Natural variantiVAR_0411041103P → L1 PublicationCorresponds to variant dbSNP:rs56334571Ensembl.1
Natural variantiVAR_0411051135A → V1 PublicationCorresponds to variant dbSNP:rs55670811Ensembl.1
Natural variantiVAR_0411061178E → D in a gastric adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs757589345Ensembl.1
Natural variantiVAR_0411071234R → W1 PublicationCorresponds to variant dbSNP:rs55916864Ensembl.1
Natural variantiVAR_0411081340R → Q1 PublicationCorresponds to variant dbSNP:rs34994343Ensembl.1
Natural variantiVAR_0411091621R → C1 PublicationCorresponds to variant dbSNP:rs55646900Ensembl.1
Natural variantiVAR_0411101903R → W in an ovarian mucinous carcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs762000831Ensembl.1
Natural variantiVAR_0597692189P → L. Corresponds to variant dbSNP:rs10755037EnsemblClinVar.1
Natural variantiVAR_0411112687P → T3 PublicationsCorresponds to variant dbSNP:rs13026308Ensembl.1
Natural variantiVAR_0411122742V → M in a gastric adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs566841339Ensembl.1
Natural variantiVAR_0718082757G → V in CNM5. 1 PublicationCorresponds to variant dbSNP:rs587777676EnsemblClinVar.1
Natural variantiVAR_0411133079H → R1 PublicationCorresponds to variant dbSNP:rs12464085EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0182581 – 849Missing in isoform 3. 3 PublicationsAdd BLAST849
Alternative sequenceiVSP_0182591 – 792Missing in isoform 2. 1 PublicationAdd BLAST792
Alternative sequenceiVSP_018261961 – 962AH → GE in isoform 2 and isoform 3. 4 Publications2
Alternative sequenceiVSP_018262963 – 3267Missing in isoform 2 and isoform 3. 4 PublicationsAdd BLAST2305
Alternative sequenceiVSP_0360713209 – 3267LQDCL…YPGGP → SCLSVCHKEIKMASS in isoform 1. 3 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U57099 mRNA Translation: AAC50599.1
AK126500 mRNA Translation: BAC86568.1
AK289531 mRNA Translation: BAF82220.1
CR542201 mRNA Translation: CAG46998.1
AC053503 Genomic DNA Translation: AAY15052.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70747.1
BC006346 mRNA Translation: AAH06346.1
DQ395348 mRNA Translation: ABD61734.1 Frameshift.
AY603755 mRNA Translation: AAT80901.1
AB037718 mRNA Translation: BAA92535.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42824.1 [Q15772-5]
CCDS54432.1 [Q15772-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001166947.1, NM_001173476.1 [Q15772-4]
NP_005867.3, NM_005876.4 [Q15772-5]
XP_016858651.1, XM_017003162.1 [Q15772-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312358; ENSP00000311684; ENSG00000072195 [Q15772-5]
ENST00000396686; ENSP00000379917; ENSG00000072195 [Q15772-4]
ENST00000396688; ENSP00000379919; ENSG00000072195 [Q15772-4]
ENST00000396689; ENSP00000379920; ENSG00000072195 [Q15772-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10290

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10290

UCSC genome browser

More...
UCSCi
uc002vlq.4 human [Q15772-5]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U57099 mRNA Translation: AAC50599.1
AK126500 mRNA Translation: BAC86568.1
AK289531 mRNA Translation: BAF82220.1
CR542201 mRNA Translation: CAG46998.1
AC053503 Genomic DNA Translation: AAY15052.1 Sequence problems.
CH471063 Genomic DNA Translation: EAW70747.1
BC006346 mRNA Translation: AAH06346.1
DQ395348 mRNA Translation: ABD61734.1 Frameshift.
AY603755 mRNA Translation: AAT80901.1
AB037718 mRNA Translation: BAA92535.1
CCDSiCCDS42824.1 [Q15772-5]
CCDS54432.1 [Q15772-4]
RefSeqiNP_001166947.1, NM_001173476.1 [Q15772-4]
NP_005867.3, NM_005876.4 [Q15772-5]
XP_016858651.1, XM_017003162.1 [Q15772-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1U2HX-ray0.96A864-960[»]
SMRiQ15772
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115579, 5 interactors
IntActiQ15772, 5 interactors
STRINGi9606.ENSP00000311684

PTM databases

iPTMnetiQ15772
PhosphoSitePlusiQ15772

Polymorphism and mutation databases

BioMutaiSPEG
DMDMi218512143

Proteomic databases

EPDiQ15772
jPOSTiQ15772
MassIVEiQ15772
MaxQBiQ15772
PaxDbiQ15772
PeptideAtlasiQ15772
PRIDEiQ15772
ProteomicsDBi60751 [Q15772-5]
60752 [Q15772-1]
60753 [Q15772-3]
60754 [Q15772-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
11575 75 antibodies

The DNASU plasmid repository

More...
DNASUi
10290

Genome annotation databases

EnsembliENST00000312358; ENSP00000311684; ENSG00000072195 [Q15772-5]
ENST00000396686; ENSP00000379917; ENSG00000072195 [Q15772-4]
ENST00000396688; ENSP00000379919; ENSG00000072195 [Q15772-4]
ENST00000396689; ENSP00000379920; ENSG00000072195 [Q15772-4]
GeneIDi10290
KEGGihsa:10290
UCSCiuc002vlq.4 human [Q15772-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10290
DisGeNETi10290

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPEG
HGNCiHGNC:16901 SPEG
HPAiENSG00000072195 Tissue enhanced (skeletal)
MalaCardsiSPEG
MIMi615950 gene
615959 phenotype
neXtProtiNX_Q15772
OpenTargetsiENSG00000072195
Orphaneti169186 Autosomal recessive centronuclear myopathy
PharmGKBiPA142672598

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0032 Eukaryota
KOG0613 Eukaryota
ENOG410XQFD LUCA
GeneTreeiENSGT00940000161126
HOGENOMiCLU_000381_0_0_1
InParanoidiQ15772
KOiK08809
OMAiRLQHDCI
OrthoDBi7796at2759
PhylomeDBiQ15772
TreeFamiTF331962

Enzyme and pathway databases

SignaLinkiQ15772

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPEG human
EvolutionaryTraceiQ15772

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SPEG

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10290
PharosiQ15772 Tbio

Protein Ontology

More...
PROi
PR:Q15772
RNActiQ15772 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072195 Expressed in esophagus and 198 other tissues
ExpressionAtlasiQ15772 baseline and differential
GenevisibleiQ15772 HS

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 11 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR015726 Ser/Thr_kin_striated-sp
IPR008271 Ser/Thr_kinase_AS
PANTHERiPTHR47633:SF3 PTHR47633:SF3, 5 hits
PfamiView protein in Pfam
PF07679 I-set, 9 hits
PF00069 Pkinase, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 9 hits
SM00408 IGc2, 9 hits
SM00220 S_TKc, 2 hits
SUPFAMiSSF48726 SSF48726, 9 hits
SSF49265 SSF49265, 1 hit
SSF56112 SSF56112, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 8 hits
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 2 hits
PS00108 PROTEIN_KINASE_ST, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPEG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15772
Secondary accession number(s): A8K0G6
, A8MRU0, Q27J74, Q695L1, Q6FGA6, Q6ZQW1, Q6ZTL8, Q9P2P9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 16, 2008
Last modified: April 22, 2020
This is version 182 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again