Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 2

Gene

DLG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc
  • ionotropic glutamate receptor binding Source: GO_Central
  • kinase binding Source: MGI
  • Ras guanyl-nucleotide exchange factor activity Source: Reactome
  • structural constituent of postsynaptic density Source: Ensembl

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442729 CREB phosphorylation through the activation of CaMKII
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DLG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000150672.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2901 DLG2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603583 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15700

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1740

Open Targets

More...
OpenTargetsi
ENSG00000150672

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164741388

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DLG2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274165

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945531 – 870Disks large homolog 2Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi7S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei28PhosphoserineBy similarity1
Modified residuei58PhosphotyrosineBy similarity1
Modified residuei65PhosphoserineBy similarity1
Modified residuei307PhosphoserineBy similarity1
Modified residuei328PhosphoserineBy similarity1
Modified residuei360PhosphoserineBy similarity1
Modified residuei365PhosphoserineBy similarity1
Modified residuei406PhosphoserineBy similarity1
Modified residuei414PhosphoserineBy similarity1
Modified residuei505PhosphotyrosineBy similarity1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei553PhosphoserineBy similarity1
Modified residuei627PhosphoserineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei750PhosphotyrosineBy similarity1
Modified residuei755PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylation of isoform 1 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15700

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15700

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15700

PeptideAtlas

More...
PeptideAtlasi
Q15700

PRoteomics IDEntifications database

More...
PRIDEi
Q15700

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60709
60710 [Q15700-2]
60711 [Q15700-3]
60712 [Q15700-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15700

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15700

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000150672 Expressed in 148 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_DLG2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15700 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15700 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB072341
HPA021307
HPA023896

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts through its PDZ domains with NETO1 (By similarity). Interacts with NOS1/nNOS through second PDZ domain (By similarity). Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (PubMed:15304517). Interacts with KCNJ4 (By similarity), Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts with FASLG (PubMed:19807924). Interacts with KCNJ4 (By similarity). Interacts with ADAM22 (By similarity).By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Kcnj2P355616EBI-663057,EBI-703793From Mus musculus.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108084, 24 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q15700

Protein interaction database and analysis system

More...
IntActi
Q15700, 21 interactors

Molecular INTeraction database

More...
MINTi
Q15700

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000365272

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15700

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15700

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15700

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini98 – 184PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini193 – 279PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini421 – 501PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini680 – 855Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

An N-terminally truncated L27 domain is predicted in isoform 2 at positions 1 through 27.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155156

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232102

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107814

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15700

KEGG Orthology (KO)

More...
KOi
K12075

Identification of Orthologs from Complete Genome Data

More...
OMAi
ERGQEDF

Database of Orthologous Groups

More...
OrthoDBi
807583at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15700

TreeFam database of animal gene trees

More...
TreeFami
TF323171

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12032 SH3_DLG2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR035759 DLG2_SH3
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF07653 SH3_2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741 MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 19 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15700-1) [UniParc]FASTAAdd to basket
Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDAPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSE VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVDDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSAPYS HYHLGLLPDS EMTSHSQHST
410 420 430 440 450
ATRQPSMTLQ RAVSLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVMLEGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGSFND KRKKSFIFSR KFPFYKNKEQ
660 670 680 690 700
SEQETSDPER GQEDLILSYE PVTRQEINYT RPVIILGPMK DRINDDLISE
710 720 730 740 750
FPDKFGSCVP HTTRPKRDYE VDGRDYHFVI SREQMEKDIQ EHKFIEAGQY
760 770 780 790 800
NDNLYGTSVQ SVRFVAERGK HCILDVSGNA IKRLQVAQLY PIAIFIKPRS
810 820 830 840 850
LEPLMEMNKR LTEEQAKKTY DRAIKLEQEF GEYFTAIVQG DTLEDIYNQC
860 870
KLVIEEQSGP FIWIPSKEKL
Length:870
Mass (Da):97,552
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBC51554590060E48
GO
Isoform 2 (identifier: Q15700-2) [UniParc]FASTAAdd to basket
Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MGIFKSSLFQ...PAWMPVHHCT

Show »
Length:975
Mass (Da):109,371
Checksum:iB4677B45F351C12D
GO
Isoform 3 (identifier: Q15700-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-86: IENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPY → MQRPSVSRAENYQLLWDTIASLKQCEQAMQHAFIP
     341-392: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Show »
Length:749
Mass (Da):83,405
Checksum:i6E4FC590B5EE8BED
GO
Isoform 4 (identifier: Q15700-4) [UniParc]FASTAAdd to basket
Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:909
Mass (Da):100,981
Checksum:i2A857BA09A6587E0
GO
Isoform 5 (identifier: Q15700-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     627-659: SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE → DIPGLGDDGYGTKTL

Note: No experimental confirmation available.Curated
Show »
Length:334
Mass (Da):38,404
Checksum:iDED1A839B4181509
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 19 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z2T4B7Z2T4_HUMAN
Disks large homolog 2
DLG2
852Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN83E9PN83_HUMAN
Disks large homolog 2
DLG2
866Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIW2E9PIW2_HUMAN
Disks large homolog 2
DLG2
811Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MCC5B5MCC5_HUMAN
Disks large homolog 2
DLG2
348Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VYC1F8VYC1_HUMAN
Disks large homolog 2
DLG2
797Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITF1A0A3B3ITF1_HUMAN
Disks large homolog 2
DLG2
1,012Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISW2A0A3B3ISW2_HUMAN
Disks large homolog 2
DLG2
890Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6ZSU2Q6ZSU2_HUMAN
Disks large homolog 2
DLG2
552Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MUT9A8MUT9_HUMAN
Disks large homolog 2
DLG2
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JFF9C9JFF9_HUMAN
Disks large homolog 2
DLG2
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD92489 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti177V → A in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti278K → N in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti704K → E in CAI45970 (PubMed:17974005).Curated1
Sequence conflicti803P → S in AAB04949 (PubMed:8755482).Curated1
Sequence conflicti861F → L in CAH18680 (PubMed:17974005).Curated1
Isoform 5 (identifier: Q15700-5)
Sequence conflicti116D → E in CAI45970 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456341 – 518Missing in isoform 5. 1 PublicationAdd BLAST518
Alternative sequenceiVSP_0155111 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA VRSAPTLIRDAHCACGWQRN CQGLGYSSQTMPSSGPGGPA SNRTGGSSFNRTLWDSVRKS PHKTSTKGKGTCGEHCTCPH GWFSPAQ in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_0155121 – 51Missing in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0155131 – 14MFFAC…RTNVK → MGIFKSSLFQALLDIQEFYE VTLLNSQKSCEQKIEEANQV LQKWEKTSLLAPCHDRLQKS SELTDCSGSKENASCIEQNK ENQSFENETDETTTQNQGRC PAQNCSVEAPAWMPVHHCT in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_01551452 – 86IENVH…DTIPY → MQRPSVSRAENYQLLWDTIA SLKQCEQAMQHAFIP in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_015515341 – 392Missing in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_015516627 – 659SFNDK…TSDPE → DIPGLGDDGYGTKTL in isoform 3 and isoform 5. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U32376 mRNA Translation: AAB04949.1
AK126776 mRNA Translation: BAC86685.1
CR749820 mRNA Translation: CAH18680.1
CR933674 mRNA Translation: CAI45970.1
AC023118 Genomic DNA No translation available.
AP000639 Genomic DNA No translation available.
AP000642 Genomic DNA No translation available.
AP000773 Genomic DNA No translation available.
AP000852 Genomic DNA No translation available.
AP000857 Genomic DNA No translation available.
AP001791 Genomic DNA No translation available.
AP001825 Genomic DNA No translation available.
AP001984 Genomic DNA No translation available.
AP002370 Genomic DNA No translation available.
AP002751 Genomic DNA No translation available.
AP002797 Genomic DNA No translation available.
AP002803 Genomic DNA No translation available.
AP002878 Genomic DNA No translation available.
AP003026 Genomic DNA No translation available.
AP003035 Genomic DNA No translation available.
AP003093 Genomic DNA No translation available.
AP003095 Genomic DNA No translation available.
AP003305 Genomic DNA No translation available.
AB209252 mRNA Translation: BAD92489.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41696.1 [Q15700-1]
CCDS44690.1 [Q15700-2]
CCDS44691.1 [Q15700-3]
CCDS44692.1 [Q15700-5]
CCDS55782.1 [Q15700-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
G01974
S60315

NCBI Reference Sequences

More...
RefSeqi
NP_001136171.1, NM_001142699.1 [Q15700-2]
NP_001136172.1, NM_001142700.1 [Q15700-3]
NP_001136174.1, NM_001142702.1 [Q15700-5]
NP_001193698.1, NM_001206769.1 [Q15700-4]
NP_001355.2, NM_001364.3 [Q15700-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.367656

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000280241; ENSP00000280241; ENSG00000150672 [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672 [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672 [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672 [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672 [Q15700-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1740

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1740

UCSC genome browser

More...
UCSCi
uc001pai.3 human [Q15700-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U32376 mRNA Translation: AAB04949.1
AK126776 mRNA Translation: BAC86685.1
CR749820 mRNA Translation: CAH18680.1
CR933674 mRNA Translation: CAI45970.1
AC023118 Genomic DNA No translation available.
AP000639 Genomic DNA No translation available.
AP000642 Genomic DNA No translation available.
AP000773 Genomic DNA No translation available.
AP000852 Genomic DNA No translation available.
AP000857 Genomic DNA No translation available.
AP001791 Genomic DNA No translation available.
AP001825 Genomic DNA No translation available.
AP001984 Genomic DNA No translation available.
AP002370 Genomic DNA No translation available.
AP002751 Genomic DNA No translation available.
AP002797 Genomic DNA No translation available.
AP002803 Genomic DNA No translation available.
AP002878 Genomic DNA No translation available.
AP003026 Genomic DNA No translation available.
AP003035 Genomic DNA No translation available.
AP003093 Genomic DNA No translation available.
AP003095 Genomic DNA No translation available.
AP003305 Genomic DNA No translation available.
AB209252 mRNA Translation: BAD92489.1 Different initiation.
CCDSiCCDS41696.1 [Q15700-1]
CCDS44690.1 [Q15700-2]
CCDS44691.1 [Q15700-3]
CCDS44692.1 [Q15700-5]
CCDS55782.1 [Q15700-4]
PIRiG01974
S60315
RefSeqiNP_001136171.1, NM_001142699.1 [Q15700-2]
NP_001136172.1, NM_001142700.1 [Q15700-3]
NP_001136174.1, NM_001142702.1 [Q15700-5]
NP_001193698.1, NM_001206769.1 [Q15700-4]
NP_001355.2, NM_001364.3 [Q15700-1]
UniGeneiHs.367656

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BYGX-ray1.85A190-283[»]
2HE2X-ray1.50A/B418-513[»]
ProteinModelPortaliQ15700
SMRiQ15700
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108084, 24 interactors
ELMiQ15700
IntActiQ15700, 21 interactors
MINTiQ15700
STRINGi9606.ENSP00000365272

PTM databases

iPTMnetiQ15700
PhosphoSitePlusiQ15700

Polymorphism and mutation databases

BioMutaiDLG2
DMDMi215274165

Proteomic databases

jPOSTiQ15700
MaxQBiQ15700
PaxDbiQ15700
PeptideAtlasiQ15700
PRIDEiQ15700
ProteomicsDBi60709
60710 [Q15700-2]
60711 [Q15700-3]
60712 [Q15700-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1740
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280241; ENSP00000280241; ENSG00000150672 [Q15700-4]
ENST00000376104; ENSP00000365272; ENSG00000150672 [Q15700-2]
ENST00000398309; ENSP00000381355; ENSG00000150672 [Q15700-1]
ENST00000418306; ENSP00000402275; ENSG00000150672 [Q15700-3]
ENST00000426717; ENSP00000393049; ENSG00000150672 [Q15700-5]
GeneIDi1740
KEGGihsa:1740
UCSCiuc001pai.3 human [Q15700-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1740
DisGeNETi1740
EuPathDBiHostDB:ENSG00000150672.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DLG2
HGNCiHGNC:2901 DLG2
HPAiCAB072341
HPA021307
HPA023896
MIMi603583 gene
neXtProtiNX_Q15700
OpenTargetsiENSG00000150672
PharmGKBiPA164741388

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000155156
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiQ15700
KOiK12075
OMAiERGQEDF
OrthoDBi807583at2759
PhylomeDBiQ15700
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442729 CREB phosphorylation through the activation of CaMKII
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DLG2 human
EvolutionaryTraceiQ15700

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DLG2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1740

Protein Ontology

More...
PROi
PR:Q15700

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000150672 Expressed in 148 organ(s), highest expression level in corpus callosum
CleanExiHS_DLG2
ExpressionAtlasiQ15700 baseline and differential
GenevisibleiQ15700 HS

Family and domain databases

CDDicd12032 SH3_DLG2, 1 hit
InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR035759 DLG2_SH3
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF07653 SH3_2, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15700
Secondary accession number(s): B7WNY8
, F8W9V6, Q59G57, Q5H9Q4, Q68CQ8, Q6ZTA8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: January 16, 2019
This is version 190 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again