UniProtKB - Q15650 (TRIP4_HUMAN)

BLAST

>sp|Q15650|TRIP4_HUMAN Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4
MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKK
GQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTE
PDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTREGQDRLAVLLPGRHPCDCLGQKHKL
INNCLICGRIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV
DISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSK
LERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGT
LNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQL
RIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQE
VSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFI
CKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

Align
Format
Add to basket Added to basket
History
Entry version 164 (07 Nov 2018)
Sequence version 4 (17 Oct 2006)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Activating signal cointegrator 1

Gene

TRIP4

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Transcription coactivator which associates with nuclear receptors, transcriptional coactivators including EP300, CREBBP and NCOA1, and basal transcription factors like TBP and TFIIA to facilitate nuclear receptors-mediated transcription. May thereby play an important role in establishing distinct coactivator complexes under different cellular conditions. Plays a role in thyroid hormone receptor and estrogen receptor transactivation (PubMed:10454579, PubMed:25219498). Also involved in androgen receptor transactivation (By similarity). Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B (PubMed:12077347). May play a role in the development of neuromuscular junction (PubMed:26924529). May play a role in late myogenic differentiation (By similarity).By similarity4 Publications

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	171 – 187	C4-typeAdd BLAST		17

GO - Molecular functionⁱ

estrogen receptor binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
histone acetyltransferase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
nuclear receptor binding
Source: UniProtKB
Inferred from direct assayⁱ
- 10454579
protease binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
protein kinase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 20873783
transcription coactivator activity
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 25219498
ubiquitin-like protein ligase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
zinc ion binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

intracellular estrogen receptor signaling pathway
Source: UniProtKB
Inferred from direct assayⁱ
- 25219498
positive regulation of transcription, DNA-templated
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 25219498
regulation of myoblast differentiation Source: UniProtKB
regulation of transcription, DNA-templated
Source: UniProtKB
Inferred from direct assayⁱ
- 12077347
toxin transport Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Transcription, Transcription regulation
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Activating signal cointegrator 11 Publication Short name: ASC-11 Publication Alternative name(s): Thyroid receptor-interacting protein 41 Publication Short name: TR-interacting protein 41 Publication Short name: TRIP-41 Publication
Gene namesⁱ	Name:TRIP4Imported
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 15

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000103671.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:12310 TRIP4
MIMⁱ	604501 gene
neXtProtⁱ	NX_Q15650

Keywords - Cellular componentⁱ

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Spinal muscular atrophy with congenital bone fractures 1 (SMABF1)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal recessive neuromuscular disorder characterized by prenatal-onset spinal muscular atrophy, multiple congenital contractures consistent with arthrogryposis multiplex congenita, respiratory distress, and congenital bone fractures.

Muscular dystrophy, congenital, Davignon-Chauveau type (MDCDC)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal recessive, severe congenital muscular dystrophy characterized by neonatal onset of muscle weakness predominantly involving axial muscles, life-threatening respiratory failure, skin abnormalities and joint hyperlaxity without contractures. Muscle biopsies show multi-minicores, caps and dystrophic lesions.

Keywords - Diseaseⁱ

Congenital muscular dystrophy, Neurodegeneration

Organism-specific databases

DisGeNET More...DisGeNETⁱ	9325
MalaCards human disease database More...MalaCardsⁱ	TRIP4
MIMⁱ	616866 phenotype 617066 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000103671
Orphanetⁱ	486815 Congenital muscular dystrophy-respiratory failure-skin abnormalities-joint hyperlaxity syndrome 486811 Prenatal-onset spinal muscular atrophy with congenital bone fractures
PharmGKBⁱ	PA36988

Polymorphism and mutation databases

BioMutaⁱ	TRIP4
DMDMⁱ	116242828

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000065631	2 – 581	Activating signal cointegrator 1Add BLAST		580

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineCombined sources	1
Modified residueⁱ	276	PhosphoserineCombined sources	1
Modified residueⁱ	289	PhosphotyrosineBy similarity	1
Cross-linkⁱ	324	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1)1 Publication
Cross-linkⁱ	325	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1)1 Publication
Cross-linkⁱ	334	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1)1 Publication
Modified residueⁱ	341	PhosphoserineCombined sources	1
Cross-linkⁱ	367	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1)1 Publication

Post-translational modificationⁱ

Phosphorylated by NEK6.1 Publication

Polyufmylated by the UFM1-conjugating system composed of the enzymes UBA5, UFC1 and UFL1. Deufmylated by the protease UFSP2. Ufmylation of TRIP4 is promoted by ligand-bound nuclear receptors that compete with UFSP2 for interaction with TRIP4. Nuclear receptors-induced ufmylation promotes the recruitment of additional transcriptional coactivators like EP300 and NCOA1 and therefore the assembly of a coactivator complex facilitating nuclear receptor-mediated transcription.1 Publication

Keywords - PTMⁱ

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	Q15650
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q15650
PaxDbⁱ	Q15650
PeptideAtlas More...PeptideAtlasⁱ	Q15650
PRIDEⁱ	Q15650
ProteomicsDBⁱ	60688

PTM databases

iPTMnetⁱ	Q15650
PhosphoSitePlusⁱ	Q15650

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000103671 Expressed in 220 organ(s), highest expression level in amniotic fluid
CleanExⁱ	HS_TRIP4
ExpressionAtlasⁱ	Q15650 baseline and differential
Genevisibleⁱ	Q15650 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA016605 HPA050666

HPAⁱ

HPA016605
HPA050666

Interactionⁱ

Subunit structureⁱ

Interacts with the thyroid hormone receptor/TR (via the ligand-binding domain); this interaction requires the presence of thyroid hormone (PubMed:10454579). Interacts with the androgen receptor/AR; in an androgen, testosterone and dihydrotestosterone-dependent manner (PubMed:12390891). Interacts with ESR1 (estrogen ligand-bound); competes with UFSP2 (PubMed:10454579, PubMed:25219498). Interacts with UFSP2; competes with ligand-bound ESR1 (PubMed:25219498). Interacts with DDRGK1 and UFL1; the interaction with DDRGK1 is direct (PubMed:25219498). Interacts with NCOA1 (PubMed:25219498). Interacts with EP300 (PubMed:25219498). Part of the ASC-1 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3 (PubMed:12077347). Interacts with NEK6 (PubMed:20873783). Interacts with CSRP1 (PubMed:26924529).6 Publications

GO - Molecular functionⁱ

estrogen receptor binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
histone acetyltransferase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
nuclear receptor binding
Source: UniProtKB
Inferred from direct assayⁱ
- 10454579
protease binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498
protein kinase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 20873783
ubiquitin-like protein ligase binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 25219498

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	114735, 51 interactors
CORUMⁱ	Q15650
IntActⁱ	Q15650, 11 interactors
STRINGⁱ	9606.ENSP00000261884

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	435 – 439	Combined sources	5
Helixⁱ	443 – 448	Combined sources	6
Beta strandⁱ	454 – 459	Combined sources	6
Beta strandⁱ	465 – 471	Combined sources	7
Helixⁱ	478 – 492	Combined sources	15
Beta strandⁱ	504 – 518	Combined sources	15
Helixⁱ	521 – 525	Combined sources	5
Turnⁱ	530 – 532	Combined sources	3
Beta strandⁱ	535 – 546	Combined sources	12
Beta strandⁱ	557 – 561	Combined sources	5
Helixⁱ	564 – 572	Combined sources	9
Helixⁱ	573 – 575	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	Q15650
SMRⁱ	Q15650
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q15650

EvolutionaryTraceⁱ

Q15650

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	200 – 300	Mediates interaction with DDRGK11 PublicationAdd BLAST		101
Regionⁱ	300 – 400	Mediates interaction with UFL11 PublicationAdd BLAST		101

Domainⁱ

The C4-type zinc finger mediates a competitive interaction with UFSP2 and ligand-bound nuclear receptors. It also mediates interaction with the transcriptional coactivators and the basal transcription machinery.3 Publications

Zinc finger

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	171 – 187	C4-typeAdd BLAST		17

Keywords - Domainⁱ

Zinc-finger

Phylogenomic databases

eggNOGⁱ	KOG2845 Eukaryota ENOG410XTTP LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000005300
HOGENOMⁱ	HOG000006873
HOVERGENⁱ	HBG061618
InParanoidⁱ	Q15650
OMAⁱ	KGKHKIW
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G096V
PhylomeDBⁱ	Q15650
TreeFamⁱ	TF314842

Family and domain databases

InterProⁱ	View protein in InterPro IPR007374 ASCH_domain IPR015947 PUA-like_sf IPR039128 TRIP4-like IPR009349 Znf_C2HC5
PANTHERⁱ	PTHR12963 PTHR12963, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF04266 ASCH, 1 hit PF06221 zf-C2HC5, 1 hit
SMARTⁱ	View protein in SMART SM01022 ASCH, 1 hit
SUPFAMⁱ	SSF88697 SSF88697, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 5 potential isoforms that are computationally mapped.Show all Align All

Q15650-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAVAGAVSGE PLVHWCTQQL RKTFGLDVSE EIIQYVLSIE SAEEIREYVT 
        60         70         80         90        100
DLLQGNEGKK GQFIEELITK WQKNDQELIS DPLQQCFKKD EILDGQKSGD 
       110        120        130        140        150
HLKRGRKKGR NRQEVPAFTE PDTTAEVKTP FDLAKAQENS NSVKKKTKFV 
       160        170        180        190        200
NLYTREGQDR LAVLLPGRHP CDCLGQKHKL INNCLICGRI VCEQEGSGPC 
       210        220        230        240        250
LFCGTLVCTH EEQDILQRDS NKSQKLLKKL MSGVENSGKV DISTKDLLPH 
       260        270        280        290        300
QELRIKSGLE KAIKHKDKLL EFDRTSIRRT QVIDDESDYF ASDSNQWLSK 
       310        320        330        340        350
LERETLQKRE EELRELRHAS RLSKKVTIDF AGRKILEEEN SLAEYHSRLD 
       360        370        380        390        400
ETIQAIANGT LNQPLTKLDR SSEEPLGVLV NPNMYQSPPQ WVDHTGAASQ 
       410        420        430        440        450
KKAFRSSGFG LEFNSFQHQL RIQDQEFQEG FDGGWCLSVH QPWASLLVRG 
       460        470        480        490        500
IKRVEGRSWY TPHRGRLWIA ATAKKPSPQE VSELQATYRL LRGKDVEFPN 
       510        520        530        540        550
DYPSGCLLGC VDLIDCLSQK QFKEQFPDIS QESDSPFVFI CKNPQEMVVK 
       560        570        580 
FPIKGNPKIW KLDSKIHQGA KKGLMKQNKA V

Length:581

Mass (Da):66,146

Last modified:October 17, 2006 - v4

Checksum:ⁱDADD3994533A808E

Computationally mapped potential isoform sequencesⁱ

There are 5 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H0YL91	H0YL91_HUMAN	Activating signal cointegrator 1 Activating signal cointegrator 1	TRIP4	368	Annotation score:
H0YLN7	H0YLN7_HUMAN	Activating signal cointegrator 1 Activating signal cointegrator 1	TRIP4	126	Annotation score:
H0YKD9	H0YKD9_HUMAN	Activating signal cointegrator 1 Activating signal cointegrator 1	TRIP4	111	Annotation score:
H0YK63	H0YK63_HUMAN	Activating signal cointegrator 1 Activating signal cointegrator 1	TRIP4	43	Annotation score:
H3BMU9	H3BMU9_HUMAN	Activating signal cointegrator 1 Activating signal cointegrator 1	TRIP4	61	Annotation score:

Sequence cautionⁱ

The sequence AAC41738 differs from that shown. Reason: Frameshift at positions 391, 444 and 476.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	157	G → R in AAF01278 (PubMed:10454579).Curated	1
Sequence conflictⁱ	157	G → R in AAC41738 (PubMed:7776974).Curated	1
Sequence conflictⁱ	164	L → A in AAF01278 (PubMed:10454579).Curated	1
Sequence conflictⁱ	475	K → N in AAC41738 (PubMed:7776974).Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF168418 mRNA Translation: AAF01278.1 AK314319 mRNA Translation: BAG36967.1 CH471082 Genomic DNA Translation: EAW77685.1 BC012448 mRNA Translation: AAH12448.1 L40371 mRNA Translation: AAC41738.1 Frameshift.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10194.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001308853.1, NM_001321924.1 NP_057297.2, NM_016213.4
UniGeneⁱ	Hs.500340

Genome annotation databases

Ensemblⁱ	ENST00000261884; ENSP00000261884; ENSG00000103671
GeneIDⁱ	9325
KEGGⁱ	hsa:9325
UCSC genome browser More...UCSCⁱ	uc002anm.3 human

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q15650	TRIP4 isoform 1		PANTR		581	UniRef90_Q15650
Activating signal cointegrator 1		MACMU		581
Uncharacterized protein		MACFA		581
Uncharacterized protein		PONAB		581
Uncharacterized protein		CERAT		581
+28

Protein	Similar proteins		Species	Score	Length	Source
Q15650	Activating signal cointegrator 1		MOUSE		581	UniRef50_Q15650
Thyroid hormone receptor interactor 4		PANTR		581
Uncharacterized protein		MACNE		581
Uncharacterized protein		MANLE		581
Uncharacterized protein		RABIT		581
+223

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF168418 mRNA Translation: AAF01278.1 AK314319 mRNA Translation: BAG36967.1 CH471082 Genomic DNA Translation: EAW77685.1 BC012448 mRNA Translation: AAH12448.1 L40371 mRNA Translation: AAC41738.1 Frameshift.
CCDSⁱ	CCDS10194.1
RefSeqⁱ	NP_001308853.1, NM_001321924.1 NP_057297.2, NM_016213.4
UniGeneⁱ	Hs.500340

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2E5O	NMR	-	A	435-581	[»]
ProteinModelPortalⁱ	Q15650
SMRⁱ	Q15650
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114735, 51 interactors
CORUMⁱ	Q15650
IntActⁱ	Q15650, 11 interactors
STRINGⁱ	9606.ENSP00000261884

PTM databases

iPTMnetⁱ	Q15650
PhosphoSitePlusⁱ	Q15650

Polymorphism and mutation databases

BioMutaⁱ	TRIP4
DMDMⁱ	116242828

Proteomic databases

EPDⁱ	Q15650
MaxQBⁱ	Q15650
PaxDbⁱ	Q15650
PeptideAtlasⁱ	Q15650
PRIDEⁱ	Q15650
ProteomicsDBⁱ	60688

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	9325
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000261884; ENSP00000261884; ENSG00000103671
GeneIDⁱ	9325
KEGGⁱ	hsa:9325
UCSCⁱ	uc002anm.3 human

Organism-specific databases

CTDⁱ	9325
DisGeNETⁱ	9325
EuPathDBⁱ	HostDB:ENSG00000103671.9
GeneCardsⁱ	TRIP4
HGNCⁱ	HGNC:12310 TRIP4
HPAⁱ	HPA016605 HPA050666
MalaCardsⁱ	TRIP4
MIMⁱ	604501 gene 616866 phenotype 617066 phenotype
neXtProtⁱ	NX_Q15650
OpenTargetsⁱ	ENSG00000103671
Orphanetⁱ	486815 Congenital muscular dystrophy-respiratory failure-skin abnormalities-joint hyperlaxity syndrome 486811 Prenatal-onset spinal muscular atrophy with congenital bone fractures
PharmGKBⁱ	PA36988
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2845 Eukaryota ENOG410XTTP LUCA
GeneTreeⁱ	ENSGT00390000005300
HOGENOMⁱ	HOG000006873
HOVERGENⁱ	HBG061618
InParanoidⁱ	Q15650
OMAⁱ	KGKHKIW
OrthoDBⁱ	EOG091G096V
PhylomeDBⁱ	Q15650
TreeFamⁱ	TF314842

Miscellaneous databases

ChiTaRSⁱ	TRIP4 human
EvolutionaryTraceⁱ	Q15650
GeneWikiⁱ	TRIP4
GenomeRNAiⁱ	9325
Protein Ontology More...PROⁱ	PR:Q15650
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000103671 Expressed in 220 organ(s), highest expression level in amniotic fluid
CleanExⁱ	HS_TRIP4
ExpressionAtlasⁱ	Q15650 baseline and differential
Genevisibleⁱ	Q15650 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR007374 ASCH_domain IPR015947 PUA-like_sf IPR039128 TRIP4-like IPR009349 Znf_C2HC5
PANTHERⁱ	PTHR12963 PTHR12963, 1 hit
Pfamⁱ	View protein in Pfam PF04266 ASCH, 1 hit PF06221 zf-C2HC5, 1 hit
SMARTⁱ	View protein in SMART SM01022 ASCH, 1 hit
SUPFAMⁱ	SSF88697 SSF88697, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TRIP4_HUMAN
Accessionⁱ	Q15650Primary (citable) accession number: Q15650 Secondary accession number(s): B2RAS0, Q96ED7, Q9UKH0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	October 17, 2006
	Last modified:	November 7, 2018
	This is version 164 of the entry and version 4 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 15
Human chromosome 15: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q15650 (TRIP4_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Activating signal cointegrator 1

TRIP4

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoskeleton

Nucleus

Cytosol

Cytoskeleton

Cytosol

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Zinc finger

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ