Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

2'-5'-oligoadenylate synthase-like protein

Gene

OASL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.3 Publications

Caution

This is the ortholog of mouse OASL1.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: InterPro
  • DNA binding Source: UniProtKB
  • double-stranded RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB
  • thyroid hormone receptor binding Source: UniProtKB
  • transferase activity Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processAntiviral defense, Immunity, Innate immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-877300 Interferon gamma signaling
R-HSA-8983711 OAS antiviral response
R-HSA-909733 Interferon alpha/beta signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
2'-5'-oligoadenylate synthase-like protein
Alternative name(s):
2'-5'-OAS-related protein
Short name:
2'-5'-OAS-RP
59 kDa 2'-5'-oligoadenylate synthase-like protein
Thyroid receptor-interacting protein 14
Short name:
TR-interacting protein 14
Short name:
TRIP-14
p59 OASL
Short name:
p59OASL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OASL
Synonyms:TRIP14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000135114.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8090 OASL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603281 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15646

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8638

Open Targets

More...
OpenTargetsi
ENSG00000135114

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31879

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
OASL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6226835

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001602662 – 5142'-5'-oligoadenylate synthase-like proteinAdd BLAST513

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15646

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15646

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15646

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15646

PeptideAtlas

More...
PeptideAtlasi
Q15646

PRoteomics IDEntifications database

More...
PRIDEi
Q15646

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60683
60684 [Q15646-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15646

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15646

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By type I interferon (IFN) and viruses.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135114 Expressed in 131 organ(s), highest expression level in epithelium of bronchus

CleanEx database of gene expression profiles

More...
CleanExi
HS_OASL

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15646 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15646 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001474

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Specifically interacts with the ligand binding domain of the thyroid receptor (TR). TRIP14 does not require the presence of thyroid hormone for its interaction. Binds MBD1.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114191, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q15646, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000257570

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1514
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WH3NMR-A434-507[»]
4XQ7X-ray1.60A1-350[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15646

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15646

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15646

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini354 – 433Ubiquitin-like 1PROSITE-ProRule annotationAdd BLAST80
Domaini434 – 509Ubiquitin-like 2PROSITE-ProRule annotationAdd BLAST76

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ubiquitin-like domains are essential for its antiviral activity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the 2-5A synthase family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0001 Eukaryota
COG5272 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000046406

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000022614

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000994

KEGG Orthology (KO)

More...
KOi
K14608

Identification of Orthologs from Complete Genome Data

More...
OMAi
WTKYYTL

Database of Orthologous Groups

More...
OrthoDBi
611234at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15646

TreeFam database of animal gene trees

More...
TreeFami
TF329749

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1410.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006117 2-5-oligoadenylate_synth_CS
IPR006116 2-5-oligoadenylate_synth_N
IPR018952 2-5-oligoAdlate_synth_1_dom2/C
IPR038121 2-5-oligoAdlate_synth_2_sf
IPR026774 2-5A_synthase
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR11258 PTHR11258, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10421 OAS1_C, 1 hit
PF00240 ubiquitin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00213 UBQ, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236 SSF54236, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00832 25A_SYNTH_1, 1 hit
PS00833 25A_SYNTH_2, 1 hit
PS50152 25A_SYNTH_3, 1 hit
PS50053 UBIQUITIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform p56 (identifier: Q15646-1) [UniParc]FASTAAdd to basket
Also known as: OASL a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALMQELYST PASRLDSFVA QWLQPHREWK EEVLDAVRTV EEFLRQEHFQ
60 70 80 90 100
GKRGLDQDVR VLKVVKVGSF GNGTVLRSTR EVELVAFLSC FHSFQEAAKH
110 120 130 140 150
HKDVLRLIWK TMWQSQDLLD LGLEDLRMEQ RVPDALVFTI QTRGTAEPIT
160 170 180 190 200
VTIVPAYRAL GPSLPNSQPP PEVYVSLIKA CGGPGNFCPS FSELQRNFVK
210 220 230 240 250
HRPTKLKSLL RLVKHWYQQY VKARSPRANL PPLYALELLT IYAWEMGTEE
260 270 280 290 300
DENFMLDEGF TTVMDLLLEY EVICIYWTKY YTLHNAIIED CVRKQLKKER
310 320 330 340 350
PIILDPADPT LNVAEGYRWD IVAQRASQCL KQDCCYDNRE NPISSWNVKR
360 370 380 390 400
ARDIHLTVEQ RGYPDFNLIV NPYEPIRKVK EKIRRTRGYS GLQRLSFQVP
410 420 430 440 450
GSERQLLSSR CSLAKYGIFS HTHIYLLETI PSEIQVFVKN PDGGSYAYAI
460 470 480 490 500
NPNSFILGLK QQIEDQQGLP KKQQQLEFQG QVLQDWLGLG IYGIQDSDTL
510
ILSKKKGEAL FPAS
Length:514
Mass (Da):59,226
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4D8BB655D9EA003E
GO
Isoform p30 (identifier: Q15646-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-255: YVKARSPRANLPPLYALELLTIYAWEMGTEEDENFM → AHHPGSGRPHPQRGRRVQMGHRCSEGLPVPETGLLL
     256-514: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):29,084
Checksum:iAB54142EF4549492
GO
Isoform 3 (identifier: Q15646-3) [UniParc]FASTAAdd to basket
Also known as: OASL d

The sequence of this isoform differs from the canonical sequence as follows:
     220-349: Missing.

Note: Has antiviral activity against RNA viruses.
Show »
Length:384
Mass (Da):43,942
Checksum:i7993256048CEFC6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YGP3H0YGP3_HUMAN
2'-5'-oligoadenylate synthase-like ...
OASL
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC41733 differs from that shown. Reason: Frameshift at position 386.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26 – 38HREWK…LDAVR → TGVEGRGARRCA in AAD28541 (PubMed:9826176).CuratedAdd BLAST13
Sequence conflicti26 – 38HREWK…LDAVR → TGVEGRGARRCA in AAD28542 (PubMed:9826176).CuratedAdd BLAST13
Sequence conflicti89S → T in AAD28542 (PubMed:9826176).Curated1
Sequence conflicti95 – 113QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28541 (PubMed:9826176).CuratedAdd BLAST19
Sequence conflicti95 – 113QEAAK…WKTMW → PGGSQASQRCSEADMENHV in AAD28542 (PubMed:9826176).CuratedAdd BLAST19
Sequence conflicti223A → S in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti317Y → I in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti321I → T in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti324Q → L in AAD28541 (PubMed:9826176).Curated1
Sequence conflicti341 – 342NP → KG in AAC41733 (PubMed:7776974).Curated2
Sequence conflicti407L → F in BAG37039 (PubMed:14702039).Curated1
Sequence conflicti445S → T in AAD28541 (PubMed:9826176).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053544341N → I. Corresponds to variant dbSNP:rs35249920Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046572220 – 349Missing in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_003743220 – 255YVKAR…DENFM → AHHPGSGRPHPQRGRRVQMG HRCSEGLPVPETGLLL in isoform p30. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_003744256 – 514Missing in isoform p30. 1 PublicationAdd BLAST259

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ225089 mRNA Translation: CAA12396.1
AF063611 mRNA Translation: AAD28541.1
AF063612 mRNA Translation: AAD28542.1
JQ792168 mRNA Translation: AFJ00074.1
AK314419 mRNA Translation: BAG37039.1
AC079602 Genomic DNA No translation available.
Z93097 Genomic DNA No translation available.
BC117408 mRNA Translation: AAI17409.1
BC117410 mRNA Translation: AAI17411.1
L40387 Genomic DNA Translation: AAC41733.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73536.1 [Q15646-3]
CCDS9211.1 [Q15646-1]
CCDS9212.1 [Q15646-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001248754.1, NM_001261825.1 [Q15646-3]
NP_003724.1, NM_003733.3 [Q15646-1]
NP_937856.1, NM_198213.2 [Q15646-2]
XP_016875630.1, XM_017020141.1 [Q15646-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.118633

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000257570; ENSP00000257570; ENSG00000135114 [Q15646-1]
ENST00000339275; ENSP00000341125; ENSG00000135114 [Q15646-2]
ENST00000620239; ENSP00000479512; ENSG00000135114 [Q15646-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8638

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8638

UCSC genome browser

More...
UCSCi
uc001tzj.3 human [Q15646-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ225089 mRNA Translation: CAA12396.1
AF063611 mRNA Translation: AAD28541.1
AF063612 mRNA Translation: AAD28542.1
JQ792168 mRNA Translation: AFJ00074.1
AK314419 mRNA Translation: BAG37039.1
AC079602 Genomic DNA No translation available.
Z93097 Genomic DNA No translation available.
BC117408 mRNA Translation: AAI17409.1
BC117410 mRNA Translation: AAI17411.1
L40387 Genomic DNA Translation: AAC41733.1 Frameshift.
CCDSiCCDS73536.1 [Q15646-3]
CCDS9211.1 [Q15646-1]
CCDS9212.1 [Q15646-2]
RefSeqiNP_001248754.1, NM_001261825.1 [Q15646-3]
NP_003724.1, NM_003733.3 [Q15646-1]
NP_937856.1, NM_198213.2 [Q15646-2]
XP_016875630.1, XM_017020141.1 [Q15646-2]
UniGeneiHs.118633

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WH3NMR-A434-507[»]
4XQ7X-ray1.60A1-350[»]
ProteinModelPortaliQ15646
SMRiQ15646
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114191, 9 interactors
IntActiQ15646, 8 interactors
STRINGi9606.ENSP00000257570

PTM databases

iPTMnetiQ15646
PhosphoSitePlusiQ15646

Polymorphism and mutation databases

BioMutaiOASL
DMDMi6226835

Proteomic databases

EPDiQ15646
jPOSTiQ15646
MaxQBiQ15646
PaxDbiQ15646
PeptideAtlasiQ15646
PRIDEiQ15646
ProteomicsDBi60683
60684 [Q15646-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8638
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257570; ENSP00000257570; ENSG00000135114 [Q15646-1]
ENST00000339275; ENSP00000341125; ENSG00000135114 [Q15646-2]
ENST00000620239; ENSP00000479512; ENSG00000135114 [Q15646-3]
GeneIDi8638
KEGGihsa:8638
UCSCiuc001tzj.3 human [Q15646-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8638
DisGeNETi8638
EuPathDBiHostDB:ENSG00000135114.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
OASL
HGNCiHGNC:8090 OASL
HPAiHPA001474
MIMi603281 gene
neXtProtiNX_Q15646
OpenTargetsiENSG00000135114
PharmGKBiPA31879

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0001 Eukaryota
COG5272 LUCA
GeneTreeiENSGT00510000046406
HOGENOMiHOG000022614
HOVERGENiHBG000994
KOiK14608
OMAiWTKYYTL
OrthoDBi611234at2759
PhylomeDBiQ15646
TreeFamiTF329749

Enzyme and pathway databases

ReactomeiR-HSA-877300 Interferon gamma signaling
R-HSA-8983711 OAS antiviral response
R-HSA-909733 Interferon alpha/beta signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
OASL human
EvolutionaryTraceiQ15646

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
OASL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8638

Protein Ontology

More...
PROi
PR:Q15646

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135114 Expressed in 131 organ(s), highest expression level in epithelium of bronchus
CleanExiHS_OASL
ExpressionAtlasiQ15646 baseline and differential
GenevisibleiQ15646 HS

Family and domain databases

Gene3Di1.10.1410.20, 1 hit
InterProiView protein in InterPro
IPR006117 2-5-oligoadenylate_synth_CS
IPR006116 2-5-oligoadenylate_synth_N
IPR018952 2-5-oligoAdlate_synth_1_dom2/C
IPR038121 2-5-oligoAdlate_synth_2_sf
IPR026774 2-5A_synthase
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PANTHERiPTHR11258 PTHR11258, 1 hit
PfamiView protein in Pfam
PF10421 OAS1_C, 1 hit
PF00240 ubiquitin, 1 hit
SMARTiView protein in SMART
SM00213 UBQ, 2 hits
SUPFAMiSSF54236 SSF54236, 2 hits
PROSITEiView protein in PROSITE
PS00832 25A_SYNTH_1, 1 hit
PS00833 25A_SYNTH_2, 1 hit
PS50152 25A_SYNTH_3, 1 hit
PS50053 UBIQUITIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOASL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15646
Secondary accession number(s): B2RAZ2
, I1YDD2, O75686, Q17R95, Q9Y6K6, Q9Y6K7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 30, 2000
Last modified: January 16, 2019
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again