Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15637 (SF01_HUMAN)

Entry version 203 (16 Oct 2019)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Splicing factor 1

Gene

SF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri277 – 296CCHC-typePROSITE-ProRule annotationAdd BLAST20

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor, RNA-binding
Biological processmRNA processing, mRNA splicing, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-72163 mRNA Splicing - Major Pathway

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q15637

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q15637 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Splicing factor 1
Alternative name(s):
Mammalian branch point-binding protein
Short name:
BBP
Short name:
mBBP
Transcription factor ZFM1
Zinc finger gene in MEN1 locus
Zinc finger protein 162
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SF1
Synonyms:ZFM1, ZNF162
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12950 SF1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601516 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15637

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi15 – 17KKR → EED: Abolishes interaction with U2AF2. 3
Mutagenesisi16 – 18KRK → EDE: Abolishes interaction with U2AF2. 1 Publication3
Mutagenesisi20S → A: Strongly decreases interaction with U2AF2 and spliceosome assembly. 1 Publication1
Mutagenesisi20S → T: Decreases interaction with U2AF2. 1 Publication1
Mutagenesisi21R → A: Decreases interaction with U2AF2 and spliceosome assembly. 1 Publication1
Mutagenesisi21R → K: No effect. 1 Publication1
Mutagenesisi22W → A: Abolishes interaction with U2AF2. 1 Publication1
Mutagenesisi22W → F: No effect. 1 Publication1
Mutagenesisi151N → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi160R → A: Strongly reduces RNA-binding. 1 Publication1
Mutagenesisi184K → A: Abolishes RNA-binding. 1 Publication1
Mutagenesisi244L → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi247L → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi254L → A: Slightly decreases RNA-binding. 1 Publication1
Mutagenesisi255R → A: Slightly decreases RNA-binding. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		7536

Open Targets

More...OpenTargetsi		ENSG00000168066

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37533

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15637

Chemistry databases

Drug and drug target database

More...DrugBanki		DB11638 Artenimol

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SF1

Domain mapping of disease mutations (DMDM)

More...DMDMi		38258418

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000501292 – 639Splicing factor 1Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei14PhosphoserineCombined sources1
Modified residuei20Phosphoserine; by PKG1 Publication1
Modified residuei80PhosphoserineCombined sources1
Modified residuei82PhosphoserineCombined sources1
Modified residuei87PhosphotyrosineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Isoform 6 (identifier: Q15637-6)
Modified residuei463PhosphoserineCombined sources1
Modified residuei467Omega-N-methylarginineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation on Ser-20 interferes with U2AF2 binding and spliceosome assembly. Isoform 6 is phosphorylated on Ser-463.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15637

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15637

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15637

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15637

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15637

PeptideAtlas

More...PeptideAtlasi		Q15637

PRoteomics IDEntifications database

More...PRIDEi		Q15637

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		10457
60669 [Q15637-1]
60670 [Q15637-2]
60671 [Q15637-3]
60672 [Q15637-4]
60673 [Q15637-5]
60674 [Q15637-6]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q15637-4 [Q15637-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15637

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15637

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q15637

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in lung, ovary, adrenal gland, colon, kidney, muscle, pancreas, thyroid, placenta, brain, liver and heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000168066 Expressed in 242 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15637 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15637 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA018883

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds U2AF2.

Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15.

Interacts with RBM17.

7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		113368, 169 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q15637

Database of interacting proteins

More...DIPi		DIP-29410N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q15637

Protein interaction database and analysis system

More...IntActi		Q15637, 219 interactors

Molecular INTeraction database

More...MINTi		Q15637

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000366604

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1639
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15637

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q15637

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini141 – 222KHPROSITE-ProRule annotationAdd BLAST82

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi15 – 19Nuclear localization signalSequence analysis5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi324 – 637Pro-richAdd BLAST314

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BBP/SF1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri277 – 296CCHC-typePROSITE-ProRule annotationAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0119 Eukaryota
COG5176 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157258

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000237321

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15637

KEGG Orthology (KO)

More...KOi		K13095

Identification of Orthologs from Complete Genome Data

More...OMAi		GAAPWHQ

Database of Orthologous Groups

More...OrthoDBi		887669at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15637

TreeFam database of animal gene trees

More...TreeFami		TF319159

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1370.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR031150 BBP/SF1
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR032570 SF1-HH
IPR001878 Znf_CCHC

The PANTHER Classification System

More...PANTHERi		PTHR11208:SF45 PTHR11208:SF45, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00013 KH_1, 1 hit
PF16275 SF1-HH, 1 hit
PF00098 zf-CCHC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00322 KH, 1 hit
SM00343 ZnF_C2HC, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54791 SSF54791, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50084 KH_TYPE_1, 1 hit
PS50158 ZF_CCHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15637-1) [UniParc]FASTAAdd to basket
Also known as: SF1-HL1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGANATPL DFPSKKRKRS RWNQDTMEQK TVIPGMPTVI PPGLTREQER 
        60         70         80         90        100
AYIVQLQIED LTRKLRTGDL GIPPNPEDRS PSPEPIYNSE GKRLNTREFR 
       110        120        130        140        150
TRKKLEEERH NLITEMVALN PDFKPPADYK PPATRVSDKV MIPQDEYPEI 
       160        170        180        190        200
NFVGLLIGPR GNTLKNIEKE CNAKIMIRGK GSVKEGKVGR KDGQMLPGED 
       210        220        230        240        250
EPLHALVTAN TMENVKKAVE QIRNILKQGI ETPEDQNDLR KMQLRELARL 
       260        270        280        290        300
NGTLREDDNR ILRPWQSSET RSITNTTVCT KCGGAGHIAS DCKFQRPGDP 
       310        320        330        340        350
QSAQDKARMD KEYLSLMAEL GEAPVPASVG STSGPATTPL ASAPRPAAPA 
       360        370        380        390        400
NNPPPPSLMS TTQSRPPWMN SGPSESRPYH GMHGGGPGGP GGGPHSFPHP 
       410        420        430        440        450
LPSLTGGHGG HPMQHNPNGP PPPWMQPPPP PMNQGPHPPG HHGPPPMDQY 
       460        470        480        490        500
LGSTPVGSGV YRLHQGKGMM PPPPMGMMPP PPPPPSGQPP PPPSGPLPPW 
       510        520        530        540        550
QQQQQQPPPP PPPSSSMASS TPLPWQQNTT TTTTSAGTGS IPPWQQQQAA 
       560        570        580        590        600
AAASPGAPQM QGNPTMVPLP PGVQPPLPPG APPPPPPPPP GSAGMMYAPP 
       610        620        630 
PPPPPPMDPS NFVTMMGMGV AGMPPFGMPP APPPPPPQN
Length:639
Mass (Da):68,330
Last modified:January 23, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEEBC6A02B29DAE4D
GO
Isoform 2 (identifier: Q15637-2) [UniParc]FASTAAdd to basket
Also known as: SF1-Bo, Bone

The sequence of this isoform differs from the canonical sequence as follows:
     597-639: YAPPPPPPPP...PAPPPPPPQN → IPPRGGDGPS...WWTGWFGKAA

Show »
Length:638
Mass (Da):68,633
Checksum:i06044F670EDC10C9
GO
Isoform 3 (identifier: Q15637-3) [UniParc]FASTAAdd to basket
Also known as: ZFM1-A, ZFM1-ABCDEF

The sequence of this isoform differs from the canonical sequence as follows:
     587-639: PPPPGSAGMM...PAPPPPPPQN → RSIECLLCLL...PSPRRRWPEP

Show »
Length:623
Mass (Da):67,277
Checksum:iC07C74BBDC4093B7
GO
Isoform 4 (identifier: Q15637-4) [UniParc]FASTAAdd to basket
Also known as: ZFM1-B, ZFM1-ABCDF

The sequence of this isoform differs from the canonical sequence as follows:
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Show »
Length:548
Mass (Da):59,712
Checksum:iDDB42B66ABA2AD18
GO
Isoform 5 (identifier: Q15637-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-10: L → LGKLGPPGLP...QQPGPAGGGG
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Note: No experimental confirmation available.
Show »
Length:673
Mass (Da):71,752
Checksum:i8F39B77A4DAE9FBD
GO
Isoform 6 (identifier: Q15637-6) [UniParc]FASTAAdd to basket
Also known as: ZFM1-D, B6

The sequence of this isoform differs from the canonical sequence as follows:
     448-548: DQYLGSTPVG...GSIPPWQQQQ → GKSVPGKYACGLWGLSPASRKRYDAATTYGHDA
     555-639: PGAPQMQGNP...PAPPPPPPQN → QWAAPTPSLW...WWTGWFGKAA

Show »
Length:571
Mass (Da):61,889
Checksum:i5DA04D16D93EBDD5
GO
Isoform 7 (identifier: Q15637-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.

Note: No experimental confirmation available.
Show »
Length:613
Mass (Da):65,371
Checksum:iC1EBBE4FC3AA66BF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J792C9J792_HUMAN
Splicing factor 1
SF1
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0N4H7C0N4_HUMAN
Splicing factor 1
SF1
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C561H7C561_HUMAN
Splicing factor 1
SF1
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEV5F8WEV5_HUMAN
Splicing factor 1
SF1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZT1H7BZT1_HUMAN
Splicing factor 1
SF1
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEG7F8WEG7_HUMAN
Splicing factor 1
SF1
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH00773 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti269E → G in BAA05116 (PubMed:7912130).Curated1
Sequence conflicti269E → G in BAA05117 (PubMed:7912130).Curated1
Sequence conflicti348A → R in AAB03514 (PubMed:9192847).Curated1
Sequence conflicti348A → R in AAB04033 (PubMed:9192847).Curated1
Sequence conflicti377R → W in BAA05116 (PubMed:7912130).Curated1
Sequence conflicti377R → W in BAA05117 (PubMed:7912130).Curated1
Sequence conflicti570P → L in BAH11587 (PubMed:14702039).Curated1
Sequence conflicti591G → V in AAB04033 (PubMed:9192847).Curated1
Sequence conflicti623M → I in AAB04033 (PubMed:9192847).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017196357S → T1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0452741 – 26Missing in isoform 7. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_00883310L → LGKLGPPGLPPLPGPKGGFE PGPPPAPGPGAGLLAPGPPP PPPVGSMGALTAAFPFAALP PPPPPPPPPPPQQPPPPPPP PSPGASYPPPQPPPPPPLYQ RVSPPQPPPPQPPRKDQQPG PAGGGG in isoform 5. 1 Publication1
Alternative sequenceiVSP_008834448 – 548DQYLG…WQQQQ → GKSVPGKYACGLWGLSPASR KRYDAATTYGHDA in isoform 6. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_008835528 – 548NTTTT…WQQQQ → RSLPAAAMARAMRVRTFRAH W in isoform 4 and isoform 5. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_008836549 – 639Missing in isoform 4 and isoform 5. 2 PublicationsAdd BLAST91
Alternative sequenceiVSP_008837555 – 639PGAPQ…PPPQN → QWAAPTPSLWSSSPMATTAA AASATPSAQQQYGFQYPLAM AAKIPPRGGDGPSHESEDFP RPLVTLPGRQPQQRPWWTGW FGKAA in isoform 6. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_008838587 – 639PPPPG…PPPQN → RSIECLLCLLSLLTQLPLPL PKPGRQDPSPRRRWPEP in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_008839597 – 639YAPPP…PPPQN → IPPRGGDGPSHESEDFPRPL VTLPGRQPQQRPWWTGWFGK AA in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y08765 mRNA Translation: CAA70018.1
Y08766 mRNA Translation: CAA70019.1
L49345 mRNA Translation: AAB03514.1
L49380 mRNA Translation: AAB04033.1
D26120 mRNA Translation: BAA05116.1
D26120 mRNA Translation: BAA05117.1
AK293753 mRNA Translation: BAH11587.1
AP001462 Genomic DNA No translation available.
BC000773 mRNA Translation: AAH00773.1 Different initiation.
BC008080 mRNA Translation: AAH08080.1
BC008724 mRNA Translation: AAH08724.1
BC011657 mRNA No translation available.
BC020217 mRNA Translation: AAH20217.1
BC038446 mRNA Translation: AAH38446.1
AJ000051, AJ000052 Genomic DNA Translation: CAA03883.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31599.1 [Q15637-1]
CCDS44642.2 [Q15637-6]
CCDS53660.1 [Q15637-7]
CCDS53661.1 [Q15637-5]
CCDS8080.1 [Q15637-2]
CCDS8081.1 [Q15637-4]

Protein sequence database of the Protein Information Resource

More...PIRi		G02919

NCBI Reference Sequences

More...RefSeqi		NP_001171501.1, NM_001178030.1 [Q15637-5]
NP_001171502.1, NM_001178031.2 [Q15637-7]
NP_001333292.1, NM_001346363.1
NP_001333293.1, NM_001346364.1
NP_004621.2, NM_004630.3 [Q15637-1]
NP_973724.1, NM_201995.2 [Q15637-2]
NP_973727.1, NM_201998.2 [Q15637-4]
XP_016873733.1, XM_017018244.1 [Q15637-7]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000227503; ENSP00000227503; ENSG00000168066 [Q15637-4]
ENST00000334944; ENSP00000334414; ENSG00000168066 [Q15637-2]
ENST00000377387; ENSP00000366604; ENSG00000168066 [Q15637-5]
ENST00000377390; ENSP00000366607; ENSG00000168066 [Q15637-1]
ENST00000377394; ENSP00000366611; ENSG00000168066 [Q15637-6]
ENST00000433274; ENSP00000396793; ENSG00000168066 [Q15637-7]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7536

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7536

UCSC genome browser

More...UCSCi		uc001oaz.3 human [Q15637-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08765 mRNA Translation: CAA70018.1
Y08766 mRNA Translation: CAA70019.1
L49345 mRNA Translation: AAB03514.1
L49380 mRNA Translation: AAB04033.1
D26120 mRNA Translation: BAA05116.1
D26120 mRNA Translation: BAA05117.1
AK293753 mRNA Translation: BAH11587.1
AP001462 Genomic DNA No translation available.
BC000773 mRNA Translation: AAH00773.1 Different initiation.
BC008080 mRNA Translation: AAH08080.1
BC008724 mRNA Translation: AAH08724.1
BC011657 mRNA No translation available.
BC020217 mRNA Translation: AAH20217.1
BC038446 mRNA Translation: AAH38446.1
AJ000051, AJ000052 Genomic DNA Translation: CAA03883.1
CCDSiCCDS31599.1 [Q15637-1]
CCDS44642.2 [Q15637-6]
CCDS53660.1 [Q15637-7]
CCDS53661.1 [Q15637-5]
CCDS8080.1 [Q15637-2]
CCDS8081.1 [Q15637-4]
PIRiG02919
RefSeqiNP_001171501.1, NM_001178030.1 [Q15637-5]
NP_001171502.1, NM_001178031.2 [Q15637-7]
NP_001333292.1, NM_001346363.1
NP_001333293.1, NM_001346364.1
NP_004621.2, NM_004630.3 [Q15637-1]
NP_973724.1, NM_201995.2 [Q15637-2]
NP_973727.1, NM_201998.2 [Q15637-4]
XP_016873733.1, XM_017018244.1 [Q15637-7]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K1GNMR-A133-260[»]
1O0PNMR-B13-25[»]
1OPINMR-B13-25[»]
2M09NMR-A27-145[»]
2M0GNMR-A1-145[»]
4FXWX-ray2.29B/D14-132[»]
4FXXX-ray2.48A/B/C/D26-132[»]
SMRiQ15637
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi113368, 169 interactors
CORUMiQ15637
DIPiDIP-29410N
ELMiQ15637
IntActiQ15637, 219 interactors
MINTiQ15637
STRINGi9606.ENSP00000366604

Chemistry databases

DrugBankiDB11638 Artenimol

Protein family/group databases

MoonDBiQ15637 Predicted

PTM databases

iPTMnetiQ15637
PhosphoSitePlusiQ15637
SwissPalmiQ15637

Polymorphism and mutation databases

BioMutaiSF1
DMDMi38258418

Proteomic databases

EPDiQ15637
jPOSTiQ15637
MassIVEiQ15637
MaxQBiQ15637
PaxDbiQ15637
PeptideAtlasiQ15637
PRIDEiQ15637
ProteomicsDBi10457
60669 [Q15637-1]
60670 [Q15637-2]
60671 [Q15637-3]
60672 [Q15637-4]
60673 [Q15637-5]
60674 [Q15637-6]
TopDownProteomicsiQ15637-4 [Q15637-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		7536

Genome annotation databases

EnsembliENST00000227503; ENSP00000227503; ENSG00000168066 [Q15637-4]
ENST00000334944; ENSP00000334414; ENSG00000168066 [Q15637-2]
ENST00000377387; ENSP00000366604; ENSG00000168066 [Q15637-5]
ENST00000377390; ENSP00000366607; ENSG00000168066 [Q15637-1]
ENST00000377394; ENSP00000366611; ENSG00000168066 [Q15637-6]
ENST00000433274; ENSP00000396793; ENSG00000168066 [Q15637-7]
GeneIDi7536
KEGGihsa:7536
UCSCiuc001oaz.3 human [Q15637-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7536
DisGeNETi7536

GeneCards: human genes, protein and diseases

More...GeneCardsi		SF1
HGNCiHGNC:12950 SF1
HPAiHPA018883
MIMi601516 gene
neXtProtiNX_Q15637
OpenTargetsiENSG00000168066
PharmGKBiPA37533

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0119 Eukaryota
COG5176 LUCA
GeneTreeiENSGT00940000157258
HOGENOMiHOG000237321
InParanoidiQ15637
KOiK13095
OMAiGAAPWHQ
OrthoDBi887669at2759
PhylomeDBiQ15637
TreeFamiTF319159

Enzyme and pathway databases

ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway
SIGNORiQ15637

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SF1 human
EvolutionaryTraceiQ15637

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SF1_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7536
PharosiQ15637

Protein Ontology

More...PROi		PR:Q15637

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000168066 Expressed in 242 organ(s), highest expression level in testis
ExpressionAtlasiQ15637 baseline and differential
GenevisibleiQ15637 HS

Family and domain databases

Gene3Di3.30.1370.10, 1 hit
InterProiView protein in InterPro
IPR031150 BBP/SF1
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
IPR032570 SF1-HH
IPR001878 Znf_CCHC
PANTHERiPTHR11208:SF45 PTHR11208:SF45, 1 hit
PfamiView protein in Pfam
PF00013 KH_1, 1 hit
PF16275 SF1-HH, 1 hit
PF00098 zf-CCHC, 1 hit
SMARTiView protein in SMART
SM00322 KH, 1 hit
SM00343 ZnF_C2HC, 1 hit
SUPFAMiSSF54791 SSF54791, 1 hit
PROSITEiView protein in PROSITE
PS50084 KH_TYPE_1, 1 hit
PS50158 ZF_CCHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSF01_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15637
Secondary accession number(s): B7Z1Q1
, C9JJE2, Q14818, Q14819, Q15913, Q8IY00, Q92744, Q92745, Q969H7, Q9BW01, Q9UEI0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 7, 2003
Last sequence update: January 23, 2007
Last modified: October 16, 2019
This is version 203 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again