Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15555 (MARE2_HUMAN)

Entry version 183 (07 Oct 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Microtubule-associated protein RP/EB family member 2

Gene

MAPRE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q15555

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein RP/EB family member 2
Alternative name(s):
APC-binding protein EB2
End-binding protein 2
Short name:
EB2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAPRE2
Synonyms:RP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000166974.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:6891, MAPRE2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605789, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15555

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Skin creases, congenital symmetric circumferential, 2 (CSCSC2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disease characterized by multiple, symmetric, circumferential rings of folded skin, affecting primarily the limbs. Affected individuals also exhibit intellectual disability, cleft palate, and dysmorphic features.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07654068N → S in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309719EnsemblClinVar.1
Natural variantiVAR_07654187Y → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309717EnsemblClinVar.1
Natural variantiVAR_076542143R → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309720EnsemblClinVar.1

Organism-specific databases

DisGeNET

More...DisGeNETi		10982

MalaCards human disease database

More...MalaCardsi		MAPRE2
MIMi616734, phenotype

Open Targets

More...OpenTargetsi		ENSG00000166974

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2505, Multiple benign circumferential skin creases on limbs

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30635

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15555, Tbio

Protein family/group databases

Allergome; a platform for allergen knowledge

More...Allergomei		8363, Hom s RP1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MAPRE2

Domain mapping of disease mutations (DMDM)

More...DMDMi		60390165

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002134241 – 327Microtubule-associated protein RP/EB family member 2Add BLAST327
Isoform 5 (identifier: Q15555-5)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei9PhosphoserineCombined sources1
Modified residuei167PhosphotyrosineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Isoform 5 (identifier: Q15555-5)
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15555

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15555

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15555

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15555

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15555

PeptideAtlas

More...PeptideAtlasi		Q15555

PRoteomics IDEntifications database

More...PRIDEi		Q15555

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20585
25777
33949
60631 [Q15555-1]
60632 [Q15555-2]

2D gel databases

USC-OGP 2-DE database

More...OGPi		Q15555

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15555

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15555

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000166974, Expressed in C1 segment of cervical spinal cord and 246 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15555, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15555, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000166974, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DCTN1 (PubMed:14514668).

Interacts with APC (via C-terminal) (PubMed:9233623, PubMed:14514668).

Interacts with monomeric and polymerized tubulin (PubMed:10188731, PubMed:14514668, PubMed:26637975).

Interacts with SLAIN1 (PubMed:21646404).

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116178, 65 interactors

Protein interaction database and analysis system

More...IntActi		Q15555, 34 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000300249

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q15555, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15555

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini57 – 159Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST103
Domaini236 – 306EB1 C-terminalPROSITE-ProRule annotationAdd BLAST71

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni187 – 327DCTN1-bindingAdd BLAST141
Regioni259 – 302APC-bindingAdd BLAST44

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAPRE family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3000, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00490000043329

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_041744_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15555

KEGG Orthology (KO)

More...KOi		K10436

Identification of Orthologs from Complete Genome Data

More...OMAi		AYCQIID

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15555

TreeFam database of animal gene trees

More...TreeFami		TF313620

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.418.10, 1 hit
1.20.5.1160, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR004953, EB1_C
IPR036133, EB1_C_sf
IPR042180, IF_rod_dom_coil1B
IPR027328, MAPRE
IPR027735, RP1/EB2_vertebrate

The PANTHER Classification System

More...PANTHERi		PTHR10623, PTHR10623, 1 hit
PTHR10623:SF7, PTHR10623:SF7, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00307, CH, 1 hit
PF03271, EB1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF140612, SSF140612, 1 hit
SSF47576, SSF47576, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50021, CH, 1 hit
PS51230, EB1_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15555-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGPTQTLSP NGENNNDIIQ DNNGTIIPFR KHTVRGERSY SWGMAVNVYS 
        60         70         80         90        100
TSITQETMSR HDIIAWVNDI VSLNYTKVEQ LCSGAAYCQF MDMLFPGCIS 
       110        120        130        140        150
LKKVKFQAKL EHEYIHNFKL LQASFKRMNV DKVIPVEKLV KGRFQDNLDF 
       160        170        180        190        200
IQWFKKFYDA NYDGKEYDPV EARQGQDAIP PPDPGEQIFN LPKKSHHANS 
       210        220        230        240        250
PTAGAAKSSP AAKPGSTPSR PSSAKRASSS GSASKSDKDL ETQVIQLNEQ 
       260        270        280        290        300
VHSLKLALEG VEKERDFYFG KLREIELLCQ EHGQENDDLV QRLMDILYAS 
       310        320 
EEHEGHTEEP EAEEQAHEQQ PPQQEEY
Length:327
Mass (Da):37,031
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2BE99E9F9EFA83C3
GO
Isoform 2 (identifier: Q15555-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-259: HSLKLALE → MHQLWPRL
     260-327: Missing.

Show »
Length:259
Mass (Da):29,091
Checksum:i37088FEA106B1EA1
GO
Isoform 3 (identifier: Q15555-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSY → MKQNRDQKCPVSQRNSSFQQPGRKPGCS

Show »
Length:315
Mass (Da):35,741
Checksum:i7E948A0018C5C8D1
GO
Isoform 5 (identifier: Q15555-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: Missing.

Show »
Length:284
Mass (Da):32,236
Checksum:i028548689D6B82D0
GO
Isoform 4 (identifier: Q15555-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-83: MPGPTQTLSP...NYTKVEQLCS → MARTTTTSSRIITGPSFLSGSTQCAGSVPT

Show »
Length:274
Mass (Da):30,691
Checksum:i793DB6E775EBF28B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ERD8K7ERD8_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EL66K7EL66_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENB3K7ENB3_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX52M0QX52_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA83375 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti65A → G in BAA83375 (PubMed:15489334).Curated1
Sequence conflicti100S → N in BAG58966 (PubMed:14702039).Curated1
Sequence conflicti128M → K in BAG58966 (PubMed:14702039).Curated1
Sequence conflicti209S → G in BAG52251 (PubMed:14702039).Curated1
Sequence conflicti235K → I in BAH11899 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07654068N → S in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309719EnsemblClinVar.1
Natural variantiVAR_07654187Y → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309717EnsemblClinVar.1
Natural variantiVAR_076542143R → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309720EnsemblClinVar.1
Natural variantiVAR_050018162Y → C. Corresponds to variant dbSNP:rs11538993Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0460411 – 83MPGPT…EQLCS → MARTTTTSSRIITGPSFLSG STQCAGSVPT in isoform 4. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_0556711 – 43Missing in isoform 5. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0457101 – 40MPGPT…GERSY → MKQNRDQKCPVSQRNSSFQQ PGRKPGCS in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_012944252 – 259HSLKLALE → MHQLWPRL in isoform 2. 1 Publication8
Alternative sequenceiVSP_012945260 – 327Missing in isoform 2. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X94232 mRNA Translation: CAA63923.1
AB016823 mRNA Translation: BAA83375.1 Different initiation.
CR536545 mRNA Translation: CAG38782.1
BT020086 mRNA Translation: AAV38889.1
AK090945 mRNA Translation: BAG52251.1
AK296251 mRNA Translation: BAG58966.1
AK294833 mRNA Translation: BAH11899.1
AK315766 mRNA Translation: BAG38118.1
AC009277 Genomic DNA No translation available.
AC015967 Genomic DNA No translation available.
CH471088 Genomic DNA Translation: EAX01336.1
CH471088 Genomic DNA Translation: EAX01338.1
BC007318 mRNA Translation: AAH07318.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11910.1 [Q15555-1]
CCDS45850.1 [Q15555-3]
CCDS45851.1 [Q15555-5]
CCDS58619.1 [Q15555-4]

Protein sequence database of the Protein Information Resource

More...PIRi		G01037

NCBI Reference Sequences

More...RefSeqi		NP_001137298.1, NM_001143826.2 [Q15555-5]
NP_001137299.1, NM_001143827.2 [Q15555-3]
NP_001243349.1, NM_001256420.1 [Q15555-4]
NP_055083.1, NM_014268.3 [Q15555-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000300249; ENSP00000300249; ENSG00000166974 [Q15555-1]
ENST00000413393; ENSP00000396074; ENSG00000166974 [Q15555-5]
ENST00000436190; ENSP00000407723; ENSG00000166974 [Q15555-3]
ENST00000538170; ENSP00000446343; ENSG00000166974 [Q15555-4]
ENST00000588910; ENSP00000468588; ENSG00000166974 [Q15555-2]
ENST00000589699; ENSP00000464921; ENSG00000166974 [Q15555-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10982

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10982

UCSC genome browser

More...UCSCi		uc002kyf.3, human [Q15555-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94232 mRNA Translation: CAA63923.1
AB016823 mRNA Translation: BAA83375.1 Different initiation.
CR536545 mRNA Translation: CAG38782.1
BT020086 mRNA Translation: AAV38889.1
AK090945 mRNA Translation: BAG52251.1
AK296251 mRNA Translation: BAG58966.1
AK294833 mRNA Translation: BAH11899.1
AK315766 mRNA Translation: BAG38118.1
AC009277 Genomic DNA No translation available.
AC015967 Genomic DNA No translation available.
CH471088 Genomic DNA Translation: EAX01336.1
CH471088 Genomic DNA Translation: EAX01338.1
BC007318 mRNA Translation: AAH07318.1
CCDSiCCDS11910.1 [Q15555-1]
CCDS45850.1 [Q15555-3]
CCDS45851.1 [Q15555-5]
CCDS58619.1 [Q15555-4]
PIRiG01037
RefSeqiNP_001137298.1, NM_001143826.2 [Q15555-5]
NP_001137299.1, NM_001143827.2 [Q15555-3]
NP_001243349.1, NM_001256420.1 [Q15555-4]
NP_055083.1, NM_014268.3 [Q15555-1]

3D structure databases

SMRiQ15555
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116178, 65 interactors
IntActiQ15555, 34 interactors
STRINGi9606.ENSP00000300249

Protein family/group databases

Allergomei8363, Hom s RP1

PTM databases

iPTMnetiQ15555
PhosphoSitePlusiQ15555

Polymorphism and mutation databases

BioMutaiMAPRE2
DMDMi60390165

2D gel databases

OGPiQ15555

Proteomic databases

EPDiQ15555
jPOSTiQ15555
MassIVEiQ15555
MaxQBiQ15555
PaxDbiQ15555
PeptideAtlasiQ15555
PRIDEiQ15555
ProteomicsDBi20585
25777
33949
60631 [Q15555-1]
60632 [Q15555-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		8544, 391 antibodies

The DNASU plasmid repository

More...DNASUi		10982

Genome annotation databases

EnsembliENST00000300249; ENSP00000300249; ENSG00000166974 [Q15555-1]
ENST00000413393; ENSP00000396074; ENSG00000166974 [Q15555-5]
ENST00000436190; ENSP00000407723; ENSG00000166974 [Q15555-3]
ENST00000538170; ENSP00000446343; ENSG00000166974 [Q15555-4]
ENST00000588910; ENSP00000468588; ENSG00000166974 [Q15555-2]
ENST00000589699; ENSP00000464921; ENSG00000166974 [Q15555-5]
GeneIDi10982
KEGGihsa:10982
UCSCiuc002kyf.3, human [Q15555-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10982
DisGeNETi10982
EuPathDBiHostDB:ENSG00000166974.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		MAPRE2
HGNCiHGNC:6891, MAPRE2
HPAiENSG00000166974, Tissue enhanced (brain)
MalaCardsiMAPRE2
MIMi605789, gene
616734, phenotype
neXtProtiNX_Q15555
OpenTargetsiENSG00000166974
Orphaneti2505, Multiple benign circumferential skin creases on limbs
PharmGKBiPA30635

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3000, Eukaryota
GeneTreeiENSGT00490000043329
HOGENOMiCLU_041744_1_0_1
InParanoidiQ15555
KOiK10436
OMAiAYCQIID
PhylomeDBiQ15555
TreeFamiTF313620

Enzyme and pathway databases

PathwayCommonsiQ15555

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10982, 4 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MAPRE2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MAPRE2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10982
PharosiQ15555, Tbio

Protein Ontology

More...PROi		PR:Q15555
RNActiQ15555, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000166974, Expressed in C1 segment of cervical spinal cord and 246 other tissues
ExpressionAtlasiQ15555, baseline and differential
GenevisibleiQ15555, HS

Family and domain databases

Gene3Di1.10.418.10, 1 hit
1.20.5.1160, 1 hit
InterProiView protein in InterPro
IPR001715, CH-domain
IPR036872, CH_dom_sf
IPR004953, EB1_C
IPR036133, EB1_C_sf
IPR042180, IF_rod_dom_coil1B
IPR027328, MAPRE
IPR027735, RP1/EB2_vertebrate
PANTHERiPTHR10623, PTHR10623, 1 hit
PTHR10623:SF7, PTHR10623:SF7, 1 hit
PfamiView protein in Pfam
PF00307, CH, 1 hit
PF03271, EB1, 1 hit
SUPFAMiSSF140612, SSF140612, 1 hit
SSF47576, SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021, CH, 1 hit
PS51230, EB1_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMARE2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15555
Secondary accession number(s): B2RE21
, B3KR39, B4DJV4, B7Z2L3, E9PHR3, F5H1V8, G5E9I6, Q9UQ33
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: November 1, 1996
Last modified: October 7, 2020
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again