Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein RP/EB family member 2

Gene

MAPRE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).By similarity

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • microtubule binding Source: ARUK-UCL
  • microtubule plus-end binding Source: GO_Central
  • protein kinase binding Source: Ensembl

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein RP/EB family member 2
Alternative name(s):
APC-binding protein EB2
End-binding protein 2
Short name:
EB2
Gene namesi
Name:MAPRE2
Synonyms:RP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000166974.12
HGNCiHGNC:6891 MAPRE2
MIMi605789 gene
neXtProtiNX_Q15555

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Involvement in diseasei

Skin creases, congenital symmetric circumferential, 2 (CSCSC2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disease characterized by multiple, symmetric, circumferential rings of folded skin, affecting primarily the limbs. Affected individuals also exhibit intellectual disability, cleft palate, and dysmorphic features.
See also OMIM:616734
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07654068N → S in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309719Ensembl.1
Natural variantiVAR_07654187Y → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309717Ensembl.1
Natural variantiVAR_076542143R → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309720Ensembl.1

Organism-specific databases

DisGeNETi10982
MalaCardsiMAPRE2
MIMi616734 phenotype
OpenTargetsiENSG00000166974
Orphaneti2505 Multiple benign circumferential skin creases on limbs
PharmGKBiPA30635

Protein family/group databases

Allergomei8363 Hom s RP1

Polymorphism and mutation databases

BioMutaiMAPRE2
DMDMi60390165

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002134241 – 327Microtubule-associated protein RP/EB family member 2Add BLAST327
Isoform 5 (identifier: Q15555-5)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei9PhosphoserineCombined sources1
Modified residuei167PhosphotyrosineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Isoform 5 (identifier: Q15555-5)
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ15555
MaxQBiQ15555
PaxDbiQ15555
PeptideAtlasiQ15555
PRIDEiQ15555
ProteomicsDBi60631
60632 [Q15555-2]

2D gel databases

OGPiQ15555

PTM databases

iPTMnetiQ15555
PhosphoSitePlusiQ15555

Expressioni

Tissue specificityi

Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.1 Publication

Gene expression databases

BgeeiENSG00000166974 Expressed in 234 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_MAPRE2
HS_RP1
ExpressionAtlasiQ15555 baseline and differential
GenevisibleiQ15555 HS

Organism-specific databases

HPAiHPA016738
HPA016739

Interactioni

Subunit structurei

Interacts with DCTN1 (PubMed:14514668). Interacts with APC (via C-terminal) (PubMed:9233623, PubMed:14514668). Interacts with monomeric and polymerized tubulin (PubMed:10188731, PubMed:14514668, PubMed:26637975). Interacts with SLAIN1 (PubMed:21646404).5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116178, 48 interactors
IntActiQ15555, 27 interactors
STRINGi9606.ENSP00000300249

Structurei

3D structure databases

ProteinModelPortaliQ15555
SMRiQ15555
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini57 – 159Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST103
Domaini236 – 306EB1 C-terminalPROSITE-ProRule annotationAdd BLAST71

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni187 – 327DCTN1-bindingAdd BLAST141
Regioni259 – 302APC-bindingAdd BLAST44

Domaini

Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.

Sequence similaritiesi

Belongs to the MAPRE family.Curated

Phylogenomic databases

eggNOGiKOG3000 Eukaryota
COG5217 LUCA
GeneTreeiENSGT00490000043329
HOGENOMiHOG000198048
HOVERGENiHBG052410
InParanoidiQ15555
KOiK10436
OMAiEEHESHT
OrthoDBiEOG091G0FT4
PhylomeDBiQ15555
TreeFamiTF313620

Family and domain databases

Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR004953 EB1_C
IPR036133 EB1_C_sf
IPR027328 MAPRE
IPR027735 RP1/EB2_vertebrate
PANTHERiPTHR10623 PTHR10623, 1 hit
PTHR10623:SF7 PTHR10623:SF7, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF03271 EB1, 1 hit
SUPFAMiSSF140612 SSF140612, 1 hit
SSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS51230 EB1_C, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15555-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGPTQTLSP NGENNNDIIQ DNNGTIIPFR KHTVRGERSY SWGMAVNVYS
60 70 80 90 100
TSITQETMSR HDIIAWVNDI VSLNYTKVEQ LCSGAAYCQF MDMLFPGCIS
110 120 130 140 150
LKKVKFQAKL EHEYIHNFKL LQASFKRMNV DKVIPVEKLV KGRFQDNLDF
160 170 180 190 200
IQWFKKFYDA NYDGKEYDPV EARQGQDAIP PPDPGEQIFN LPKKSHHANS
210 220 230 240 250
PTAGAAKSSP AAKPGSTPSR PSSAKRASSS GSASKSDKDL ETQVIQLNEQ
260 270 280 290 300
VHSLKLALEG VEKERDFYFG KLREIELLCQ EHGQENDDLV QRLMDILYAS
310 320
EEHEGHTEEP EAEEQAHEQQ PPQQEEY
Length:327
Mass (Da):37,031
Last modified:November 1, 1996 - v1
Checksum:i2BE99E9F9EFA83C3
GO
Isoform 2 (identifier: Q15555-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-259: HSLKLALE → MHQLWPRL
     260-327: Missing.

Show »
Length:259
Mass (Da):29,091
Checksum:i37088FEA106B1EA1
GO
Isoform 3 (identifier: Q15555-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSY → MKQNRDQKCPVSQRNSSFQQPGRKPGCS

Note: No experimental confirmation available.
Show »
Length:315
Mass (Da):35,741
Checksum:i7E948A0018C5C8D1
GO
Isoform 5 (identifier: Q15555-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:284
Mass (Da):32,236
Checksum:i028548689D6B82D0
GO
Isoform 4 (identifier: Q15555-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-83: MPGPTQTLSP...NYTKVEQLCS → MARTTTTSSRIITGPSFLSGSTQCAGSVPT

Note: No experimental confirmation available.
Show »
Length:274
Mass (Da):30,691
Checksum:i793DB6E775EBF28B
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ERD8K7ERD8_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
194Annotation score:
K7ENB3K7ENB3_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
78Annotation score:
M0QX52M0QX52_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
127Annotation score:
K7EL66K7EL66_HUMAN
Microtubule-associated protein RP/E...
MAPRE2
134Annotation score:

Sequence cautioni

The sequence BAA83375 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65A → G in BAA83375 (PubMed:15489334).Curated1
Sequence conflicti100S → N in BAG58966 (PubMed:14702039).Curated1
Sequence conflicti128M → K in BAG58966 (PubMed:14702039).Curated1
Sequence conflicti209S → G in BAG52251 (PubMed:14702039).Curated1
Sequence conflicti235K → I in BAH11899 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07654068N → S in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309719Ensembl.1
Natural variantiVAR_07654187Y → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309717Ensembl.1
Natural variantiVAR_076542143R → C in CSCSC2; enhances binding to microtubules. 1 PublicationCorresponds to variant dbSNP:rs864309720Ensembl.1
Natural variantiVAR_050018162Y → C. Corresponds to variant dbSNP:rs11538993Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0460411 – 83MPGPT…EQLCS → MARTTTTSSRIITGPSFLSG STQCAGSVPT in isoform 4. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_0556711 – 43Missing in isoform 5. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0457101 – 40MPGPT…GERSY → MKQNRDQKCPVSQRNSSFQQ PGRKPGCS in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_012944252 – 259HSLKLALE → MHQLWPRL in isoform 2. 1 Publication8
Alternative sequenceiVSP_012945260 – 327Missing in isoform 2. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94232 mRNA Translation: CAA63923.1
AB016823 mRNA Translation: BAA83375.1 Different initiation.
CR536545 mRNA Translation: CAG38782.1
BT020086 mRNA Translation: AAV38889.1
AK090945 mRNA Translation: BAG52251.1
AK296251 mRNA Translation: BAG58966.1
AK294833 mRNA Translation: BAH11899.1
AK315766 mRNA Translation: BAG38118.1
AC009277 Genomic DNA No translation available.
AC015967 Genomic DNA No translation available.
CH471088 Genomic DNA Translation: EAX01336.1
CH471088 Genomic DNA Translation: EAX01338.1
BC007318 mRNA Translation: AAH07318.1
CCDSiCCDS11910.1 [Q15555-1]
CCDS45850.1 [Q15555-3]
CCDS45851.1 [Q15555-5]
CCDS58619.1 [Q15555-4]
PIRiG01037
RefSeqiNP_001137298.1, NM_001143826.2 [Q15555-5]
NP_001137299.1, NM_001143827.2 [Q15555-3]
NP_001243349.1, NM_001256420.1 [Q15555-4]
NP_055083.1, NM_014268.3 [Q15555-1]
UniGeneiHs.532824

Genome annotation databases

EnsembliENST00000300249; ENSP00000300249; ENSG00000166974 [Q15555-1]
ENST00000413393; ENSP00000396074; ENSG00000166974 [Q15555-5]
ENST00000436190; ENSP00000407723; ENSG00000166974 [Q15555-3]
ENST00000538170; ENSP00000446343; ENSG00000166974 [Q15555-4]
ENST00000588910; ENSP00000468588; ENSG00000166974 [Q15555-2]
ENST00000589699; ENSP00000464921; ENSG00000166974 [Q15555-5]
GeneIDi10982
KEGGihsa:10982
UCSCiuc002kyf.3 human [Q15555-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94232 mRNA Translation: CAA63923.1
AB016823 mRNA Translation: BAA83375.1 Different initiation.
CR536545 mRNA Translation: CAG38782.1
BT020086 mRNA Translation: AAV38889.1
AK090945 mRNA Translation: BAG52251.1
AK296251 mRNA Translation: BAG58966.1
AK294833 mRNA Translation: BAH11899.1
AK315766 mRNA Translation: BAG38118.1
AC009277 Genomic DNA No translation available.
AC015967 Genomic DNA No translation available.
CH471088 Genomic DNA Translation: EAX01336.1
CH471088 Genomic DNA Translation: EAX01338.1
BC007318 mRNA Translation: AAH07318.1
CCDSiCCDS11910.1 [Q15555-1]
CCDS45850.1 [Q15555-3]
CCDS45851.1 [Q15555-5]
CCDS58619.1 [Q15555-4]
PIRiG01037
RefSeqiNP_001137298.1, NM_001143826.2 [Q15555-5]
NP_001137299.1, NM_001143827.2 [Q15555-3]
NP_001243349.1, NM_001256420.1 [Q15555-4]
NP_055083.1, NM_014268.3 [Q15555-1]
UniGeneiHs.532824

3D structure databases

ProteinModelPortaliQ15555
SMRiQ15555
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116178, 48 interactors
IntActiQ15555, 27 interactors
STRINGi9606.ENSP00000300249

Protein family/group databases

Allergomei8363 Hom s RP1

PTM databases

iPTMnetiQ15555
PhosphoSitePlusiQ15555

Polymorphism and mutation databases

BioMutaiMAPRE2
DMDMi60390165

2D gel databases

OGPiQ15555

Proteomic databases

EPDiQ15555
MaxQBiQ15555
PaxDbiQ15555
PeptideAtlasiQ15555
PRIDEiQ15555
ProteomicsDBi60631
60632 [Q15555-2]

Protocols and materials databases

DNASUi10982
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300249; ENSP00000300249; ENSG00000166974 [Q15555-1]
ENST00000413393; ENSP00000396074; ENSG00000166974 [Q15555-5]
ENST00000436190; ENSP00000407723; ENSG00000166974 [Q15555-3]
ENST00000538170; ENSP00000446343; ENSG00000166974 [Q15555-4]
ENST00000588910; ENSP00000468588; ENSG00000166974 [Q15555-2]
ENST00000589699; ENSP00000464921; ENSG00000166974 [Q15555-5]
GeneIDi10982
KEGGihsa:10982
UCSCiuc002kyf.3 human [Q15555-1]

Organism-specific databases

CTDi10982
DisGeNETi10982
EuPathDBiHostDB:ENSG00000166974.12
GeneCardsiMAPRE2
HGNCiHGNC:6891 MAPRE2
HPAiHPA016738
HPA016739
MalaCardsiMAPRE2
MIMi605789 gene
616734 phenotype
neXtProtiNX_Q15555
OpenTargetsiENSG00000166974
Orphaneti2505 Multiple benign circumferential skin creases on limbs
PharmGKBiPA30635
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3000 Eukaryota
COG5217 LUCA
GeneTreeiENSGT00490000043329
HOGENOMiHOG000198048
HOVERGENiHBG052410
InParanoidiQ15555
KOiK10436
OMAiEEHESHT
OrthoDBiEOG091G0FT4
PhylomeDBiQ15555
TreeFamiTF313620

Miscellaneous databases

ChiTaRSiMAPRE2 human
GeneWikiiMAPRE2
GenomeRNAii10982
PROiPR:Q15555
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166974 Expressed in 234 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_MAPRE2
HS_RP1
ExpressionAtlasiQ15555 baseline and differential
GenevisibleiQ15555 HS

Family and domain databases

Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR004953 EB1_C
IPR036133 EB1_C_sf
IPR027328 MAPRE
IPR027735 RP1/EB2_vertebrate
PANTHERiPTHR10623 PTHR10623, 1 hit
PTHR10623:SF7 PTHR10623:SF7, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF03271 EB1, 1 hit
SUPFAMiSSF140612 SSF140612, 1 hit
SSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS51230 EB1_C, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMARE2_HUMAN
AccessioniPrimary (citable) accession number: Q15555
Secondary accession number(s): B2RE21
, B3KR39, B4DJV4, B7Z2L3, E9PHR3, F5H1V8, G5E9I6, Q9UQ33
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 168 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again