Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15435 (PP1R7_HUMAN)

Entry version 190 (07 Apr 2021)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Protein phosphatase 1 regulatory subunit 7

Gene

PPP1R7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of protein phosphatase 1.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q15435

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 7
Alternative name(s):
Protein phosphatase 1 regulatory subunit 22
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP1R7
Synonyms:SDS22
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9295, PPP1R7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602877, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15435

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000115685.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi148D → V: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi170F → A: Severely impaired the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi192E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi214F → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi280D → A: Severely impairs the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi300E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi302W → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi327Y → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5510

Open Targets

More...OpenTargetsi		ENSG00000115685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33658

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15435, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PPP1R7

Domain mapping of disease mutations (DMDM)

More...DMDMi		74762145

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002396132 – 360Protein phosphatase 1 regulatory subunit 7Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei24PhosphoserineCombined sources1
Modified residuei27PhosphoserineCombined sources1
Modified residuei44PhosphoserineCombined sources1
Modified residuei47PhosphoserineCombined sources1
Modified residuei322PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15435

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15435

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15435

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15435

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15435

PeptideAtlas

More...PeptideAtlasi		Q15435

PRoteomics IDEntifications database

More...PRIDEi		Q15435

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60591 [Q15435-1]
60592 [Q15435-2]
60593 [Q15435-3]
60594 [Q15435-4]
6128

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00033600

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15435

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q15435

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15435

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000115685, Expressed in testis and 247 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15435, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15435, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000115685, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111502, 70 interactors

Database of interacting proteins

More...DIPi		DIP-1005N

Protein interaction database and analysis system

More...IntActi		Q15435, 50 interactors

Molecular INTeraction database

More...MINTi		Q15435

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000234038

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q15435, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1360
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15435

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati77 – 98LRR 1Add BLAST22
Repeati99 – 120LRR 2Add BLAST22
Repeati121 – 142LRR 3Add BLAST22
Repeati143 – 164LRR 4Add BLAST22
Repeati165 – 186LRR 5Add BLAST22
Repeati187 – 208LRR 6Add BLAST22
Repeati209 – 230LRR 7Add BLAST22
Repeati231 – 252LRR 8Add BLAST22
Repeati253 – 274LRR 9Add BLAST22
Repeati275 – 296LRR 10Add BLAST22
Repeati297 – 318LRR 11Add BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini331 – 360LRRCTAdd BLAST30

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SDS22 family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0531, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158551

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15435

Identification of Orthologs from Complete Genome Data

More...OMAi		LFLRWNL

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15435

TreeFam database of animal gene trees

More...TreeFami		TF105538

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.80.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR032675, LRR_dom_sf
IPR003603, U2A'_phosphoprotein32A_C

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00369, LRR_TYP, 7 hits
SM00446, LRRcap, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51450, LRR, 12 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15435-1) [UniParc]FASTAAdd to basket
Also known as: sds22alpha1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD 
        60         70         80         90        100
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV 
       110        120        130        140        150
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS 
       160        170        180        190        200
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA 
       210        220        230        240        250
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN 
       260        270        280        290        300
LVNLRELYLS HNGIEVIEGL ENNNKLTMLD IASNRIKKIE NISHLTELQE 
       310        320        330        340        350
FWMNDNLLES WSDLDELKGA RSLETVYLER NPLQKDPQYR RKVMLALPSV 
       360
RQIDATFVRF
Length:360
Mass (Da):41,564
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49BCCF675EAA94D1
GO
Isoform 2 (identifier: Q15435-2) [UniParc]FASTAAdd to basket
Also known as: sds22alpha2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.

Show »
Length:317
Mass (Da):36,837
Checksum:i9AC120B3C729CF8B
GO
Isoform 3 (identifier: Q15435-3) [UniParc]FASTAAdd to basket
Also known as: sds22beta1

The sequence of this isoform differs from the canonical sequence as follows:
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:280
Mass (Da):32,053
Checksum:i4FE43AE30C65AB72
GO
Isoform 4 (identifier: Q15435-4) [UniParc]FASTAAdd to basket
Also known as: sds22beta2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:237
Mass (Da):27,326
Checksum:i627A59386B5763BB
GO
Isoform 5 (identifier: Q15435-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE → M
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:221
Mass (Da):25,593
Checksum:i9AB66B080F2F52C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C118H7C118_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MBZ8B5MBZ8_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
274Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JD73C9JD73_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
282Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JRC4C9JRC4_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C003H7C003_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
335Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J177C9J177_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Q5H7C3Q5_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0556721 – 60MAAER…EEDPE → M in isoform 5. CuratedAdd BLAST60
Alternative sequenceiVSP_01924418 – 60Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_019245274 – 280NKLTMLD → VQDSLTY in isoform 3, isoform 4 and isoform 5. 2 Publications7
Alternative sequenceiVSP_019246281 – 360Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST80

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z50749 mRNA Translation: CAA90626.1
AF067136 AF067135 Genomic DNA Translation: AAD26610.1
AF067136 AF067131 Genomic DNA Translation: AAD26611.1
AF067134 AF067133 Genomic DNA Translation: AAD26612.1
AF067134 AF067133 Genomic DNA Translation: AAD26613.1
BT007296 mRNA Translation: AAP35960.1
BT020134 mRNA Translation: AAV38936.1
AK294043 mRNA Translation: BAG57395.1
AC005237 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW71243.1
BC000910 mRNA Translation: AAH00910.1
BC012397 mRNA Translation: AAH12397.1
BC013001 mRNA Translation: AAH13001.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2546.1 [Q15435-1]
CCDS63190.1 [Q15435-5]
CCDS63192.1 [Q15435-3]
CCDS63193.1 [Q15435-4]
CCDS63194.1 [Q15435-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S68209

NCBI Reference Sequences

More...RefSeqi		NP_001269338.1, NM_001282409.1 [Q15435-2]
NP_001269339.1, NM_001282410.1 [Q15435-3]
NP_001269340.1, NM_001282411.1 [Q15435-4]
NP_001269341.1, NM_001282412.1
NP_001269342.1, NM_001282413.1
NP_001269343.1, NM_001282414.1 [Q15435-5]
NP_002703.1, NM_002712.2 [Q15435-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5510

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5510

UCSC genome browser

More...UCSCi		uc002was.5, human [Q15435-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50749 mRNA Translation: CAA90626.1
AF067136 AF067135 Genomic DNA Translation: AAD26610.1
AF067136 AF067131 Genomic DNA Translation: AAD26611.1
AF067134 AF067133 Genomic DNA Translation: AAD26612.1
AF067134 AF067133 Genomic DNA Translation: AAD26613.1
BT007296 mRNA Translation: AAP35960.1
BT020134 mRNA Translation: AAV38936.1
AK294043 mRNA Translation: BAG57395.1
AC005237 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW71243.1
BC000910 mRNA Translation: AAH00910.1
BC012397 mRNA Translation: AAH12397.1
BC013001 mRNA Translation: AAH13001.1
CCDSiCCDS2546.1 [Q15435-1]
CCDS63190.1 [Q15435-5]
CCDS63192.1 [Q15435-3]
CCDS63193.1 [Q15435-4]
CCDS63194.1 [Q15435-2]
PIRiS68209
RefSeqiNP_001269338.1, NM_001282409.1 [Q15435-2]
NP_001269339.1, NM_001282410.1 [Q15435-3]
NP_001269340.1, NM_001282411.1 [Q15435-4]
NP_001269341.1, NM_001282412.1
NP_001269342.1, NM_001282413.1
NP_001269343.1, NM_001282414.1 [Q15435-5]
NP_002703.1, NM_002712.2 [Q15435-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6HKWX-ray3.09A/B/C/D/E1-360[»]
6MKYX-ray2.90A/B100-360[»]
6OBNX-ray2.70C/D56-360[»]
6OBPX-ray2.70C56-360[»]
SMRiQ15435
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111502, 70 interactors
DIPiDIP-1005N
IntActiQ15435, 50 interactors
MINTiQ15435
STRINGi9606.ENSP00000234038

PTM databases

iPTMnetiQ15435
MetOSiteiQ15435
PhosphoSitePlusiQ15435

Genetic variation databases

BioMutaiPPP1R7
DMDMi74762145

2D gel databases

REPRODUCTION-2DPAGEiIPI00033600

Proteomic databases

EPDiQ15435
jPOSTiQ15435
MassIVEiQ15435
MaxQBiQ15435
PaxDbiQ15435
PeptideAtlasiQ15435
PRIDEiQ15435
ProteomicsDBi60591 [Q15435-1]
60592 [Q15435-2]
60593 [Q15435-3]
60594 [Q15435-4]
6128

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34547, 253 antibodies

The DNASU plasmid repository

More...DNASUi		5510

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1]
GeneIDi5510
KEGGihsa:5510
UCSCiuc002was.5, human [Q15435-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5510
DisGeNETi5510

GeneCards: human genes, protein and diseases

More...GeneCardsi		PPP1R7
HGNCiHGNC:9295, PPP1R7
HPAiENSG00000115685, Low tissue specificity
MIMi602877, gene
neXtProtiNX_Q15435
OpenTargetsiENSG00000115685
PharmGKBiPA33658
VEuPathDBiHostDB:ENSG00000115685.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0531, Eukaryota
GeneTreeiENSGT00940000158551
InParanoidiQ15435
OMAiLFLRWNL
PhylomeDBiQ15435
TreeFamiTF105538

Enzyme and pathway databases

PathwayCommonsiQ15435

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5510, 652 hits in 1004 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PPP1R7, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PPP1R7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5510
PharosiQ15435, Tbio

Protein Ontology

More...PROi		PR:Q15435
RNActiQ15435, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000115685, Expressed in testis and 247 other tissues
ExpressionAtlasiQ15435, baseline and differential
GenevisibleiQ15435, HS

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR032675, LRR_dom_sf
IPR003603, U2A'_phosphoprotein32A_C
SMARTiView protein in SMART
SM00369, LRR_TYP, 7 hits
SM00446, LRRcap, 1 hit
PROSITEiView protein in PROSITE
PS51450, LRR, 12 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPP1R7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15435
Secondary accession number(s): B4DFD4
, B5MCY6, Q9UQE5, Q9UQE6, Q9Y6K4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: November 1, 1996
Last modified: April 7, 2021
This is version 190 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again