UniProtKB - Q15435 (PP1R7_HUMAN)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1 MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
- Align
Protein
Protein phosphatase 1 regulatory subunit 7
Gene
PPP1R7
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Regulatory subunit of protein phosphatase 1.By similarity
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- enzyme regulator activity Source: UniProtKB <p>Non-traceable Author Statement</p> <p>Used for statements in the abstract, introduction or discussion of a paper that cannot be traced back to another publication.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#nas">GO evidence code guide</a></p> Non-traceable author statementi
- protein phosphatase regulator activity Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- chromosome segregation Source: Ensembl
- positive regulation of protein dephosphorylation Source: MGI <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Protein phosphatase 1 regulatory subunit 7Alternative name(s): Protein phosphatase 1 regulatory subunit 22 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:PPP1R7 Synonyms:SDS22 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000115685.14 |
Human Gene Nomenclature Database More...HGNCi | HGNC:9295 PPP1R7 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602877 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q15435 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Nucleus
- Nucleus By similarity
Extracellular region or secreted
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
Nucleus
Other locations
- chromosome Source: MGI <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- cytoplasm Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Nucleus<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 148 | D → V: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 170 | F → A: Severely impaired the binding of protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 192 | E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 214 | F → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 280 | D → A: Severely impairs the binding of protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 300 | E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 302 | W → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 327 | Y → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Organism-specific databases
DisGeNET More...DisGeNETi | 5510 |
Open Targets More...OpenTargetsi | ENSG00000115685 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA33658 |
Polymorphism and mutation databases
Domain mapping of disease mutations (DMDM) More...DMDMi | 74762145 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | RemovedCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000239613 | 2 – 360 | Protein phosphatase 1 regulatory subunit 7Add BLAST | 359 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 2 | N-acetylalanineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 12 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 24 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 27 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 44 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 47 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 322 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Acetylation, PhosphoproteinProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q15435 |
MaxQB - The MaxQuant DataBase More...MaxQBi | Q15435 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q15435 |
PeptideAtlas More...PeptideAtlasi | Q15435 |
PRoteomics IDEntifications database More...PRIDEi | Q15435 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 60591 60592 [Q15435-2] 60593 [Q15435-3] 60594 [Q15435-4] |
2D gel databases
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEi | IPI00033600 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q15435 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q15435 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Widely expressed.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"Molecular cloning of a human polypeptide related to yeast sds22, a regulator of protein phosphatase-1."
Renouf S., Beullens M., Wera S., Van Eynde A., Sikela J., Stalmans W., Bollen M.
FEBS Lett. 375:75-78(1995) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000115685 |
CleanEx database of gene expression profiles More...CleanExi | HS_PPP1R7 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q15435 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q15435 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA034500 HPA034501 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.8"Binding of the concave surface of the Sds22 superhelix to the alpha 4/alpha 5/alpha 6-triangle of protein phosphatase-1."
Ceulemans H., Vulsteke V., De Maeyer M., Tatchell K., Stalmans W., Bollen M.
J. Biol. Chem. 277:47331-47337(2002) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH PPP1CA; PPP1CB AND PPP1CC ISOFORM 1, MUTAGENESIS OF ASP-148; PHE-170; GLU-192; PHE-214; ASP-280; GLU-300; TRP-302 AND TYR-327.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PPP1CA | P62136 | 6 | EBI-1024281,EBI-357253 | |
| PPP1CB | P62140 | 8 | EBI-1024281,EBI-352350 | |
| PPP1CC | P36873 | 5 | EBI-1024281,EBI-356283 | |
| USHBP1 | Q8N6Y0 | 3 | EBI-1024281,EBI-739895 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111502, 60 interactors |
Database of interacting proteins More...DIPi | DIP-1005N |
Protein interaction database and analysis system More...IntActi | Q15435, 43 interactors |
Molecular INTeraction database More...MINTi | Q15435 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000234038 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q15435 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 77 – 98 | LRR 1Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 99 – 120 | LRR 2Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 121 – 142 | LRR 3Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 143 – 164 | LRR 4Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 165 – 186 | LRR 5Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 187 – 208 | LRR 6Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 209 – 230 | LRR 7Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 231 – 252 | LRR 8Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 253 – 274 | LRR 9Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 275 – 296 | LRR 10Add BLAST | 22 | |
| <p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati | 297 – 318 | LRR 11Add BLAST | 22 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 331 – 360 | LRRCTAdd BLAST | 30 |
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the SDS22 family.Curated
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
Leucine-rich repeat, RepeatPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0531 Eukaryota COG4886 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00900000140836 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000211189 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG082161 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q15435 |
KEGG Orthology (KO) More...KOi | K17550 |
Identification of Orthologs from Complete Genome Data More...OMAi | LFLRWNL |
Database of Orthologous Groups More...OrthoDBi | EOG091G0FWO |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q15435 |
TreeFam database of animal gene trees More...TreeFami | TF105538 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.80.10.10, 2 hits |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001611 Leu-rich_rpt IPR003591 Leu-rich_rpt_typical-subtyp IPR032675 LRR_dom_sf IPR003603 U2A'_phosphoprotein32A_C |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00369 LRR_TYP, 7 hits SM00446 LRRcap, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51450 LRR, 12 hits |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
Isoform 1 (identifier: Q15435-1) [UniParc]FASTAAdd to basketAdded to basketShow »
Also known as: sds22alpha1
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD
60 70 80 90 100
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV
110 120 130 140 150
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS
160 170 180 190 200
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA
210 220 230 240 250
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN
260 270 280 290 300
LVNLRELYLS HNGIEVIEGL ENNNKLTMLD IASNRIKKIE NISHLTELQE
310 320 330 340 350
FWMNDNLLES WSDLDELKGA RSLETVYLER NPLQKDPQYR RKVMLALPSV
360
RQIDATFVRF
Length:360
Mass (Da):41,564
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i49BCCF675EAA94D1
Isoform 2 (identifier: Q15435-2) [UniParc]FASTAAdd to basketAdded to basketShow »
Also known as: sds22alpha2
The sequence of this isoform differs from the canonical sequence as follows:
18-60: Missing.
10 20 30 40 50
MAAERGAGQQ QSQEMMEEEH ELPVDMETIN LDRDAEDVDL NHYRIGKIEG
60 70 80 90 100
FEVLKKVKTL CLRQNLIKCI ENLEELQSLR ELDLYDNQIK KIENLEALTE
110 120 130 140 150
LEILDISFNL LRNIEGVDKL TRLKKLFLVN NKISKIENLS NLHQLQMLEL
160 170 180 190 200
GSNRIRAIEN IDTLTNLESL FLGKNKITKL QNLDALTNLT VLSMQSNRLT
210 220 230 240 250
KIEGLQNLVN LRELYLSHNG IEVIEGLENN NKLTMLDIAS NRIKKIENIS
260 270 280 290 300
HLTELQEFWM NDNLLESWSD LDELKGARSL ETVYLERNPL QKDPQYRRKV
310
MLALPSVRQI DATFVRF
Length:317
Mass (Da):36,837
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i9AC120B3C729CF8B
Isoform 3 (identifier: Q15435-3) [UniParc]FASTAAdd to basketAdded to basketShow »
Also known as: sds22beta1
The sequence of this isoform differs from the canonical sequence as follows:
274-280: NKLTMLD → VQDSLTY
281-360: Missing.
10 20 30 40 50
MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD
60 70 80 90 100
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV
110 120 130 140 150
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS
160 170 180 190 200
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA
210 220 230 240 250
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN
260 270 280
LVNLRELYLS HNGIEVIEGL ENNVQDSLTY
Length:280
Mass (Da):32,053
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i4FE43AE30C65AB72
Isoform 4 (identifier: Q15435-4) [UniParc]FASTAAdd to basketAdded to basketShow »
Also known as: sds22beta2
The sequence of this isoform differs from the canonical sequence as follows:
18-60: Missing.
274-280: NKLTMLD → VQDSLTY
281-360: Missing.
10 20 30 40 50
MAAERGAGQQ QSQEMMEEEH ELPVDMETIN LDRDAEDVDL NHYRIGKIEG
60 70 80 90 100
FEVLKKVKTL CLRQNLIKCI ENLEELQSLR ELDLYDNQIK KIENLEALTE
110 120 130 140 150
LEILDISFNL LRNIEGVDKL TRLKKLFLVN NKISKIENLS NLHQLQMLEL
160 170 180 190 200
GSNRIRAIEN IDTLTNLESL FLGKNKITKL QNLDALTNLT VLSMQSNRLT
210 220 230
KIEGLQNLVN LRELYLSHNG IEVIEGLENN VQDSLTY
Length:237
Mass (Da):27,326
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i627A59386B5763BB
Isoform 5 (identifier: Q15435-5) [UniParc]FASTAAdd to basketAdded to basket
The sequence of this isoform differs from the canonical sequence as follows:
1-60: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE → M
274-280: NKLTMLD → VQDSLTY
281-360: Missing.
10 20 30 40 50
MEEHELPVDM ETINLDRDAE DVDLNHYRIG KIEGFEVLKK VKTLCLRQNL
60 70 80 90 100
IKCIENLEEL QSLRELDLYD NQIKKIENLE ALTELEILDI SFNLLRNIEG
110 120 130 140 150
VDKLTRLKKL FLVNNKISKI ENLSNLHQLQ MLELGSNRIR AIENIDTLTN
160 170 180 190 200
LESLFLGKNK ITKLQNLDAL TNLTVLSMQS NRLTKIEGLQ NLVNLRELYL
210 220
SHNGIEVIEG LENNVQDSLT Y
Note: No experimental confirmation available. Gene prediction based on EST data.
Show »Length:221
Mass (Da):25,593
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i9AB66B080F2F52C0
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055672 | 1 – 60 | MAAER…EEDPE → M in isoform 5. CuratedAdd BLAST | 60 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019244 | 18 – 60 | Missing in isoform 2 and isoform 4. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 43 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019245 | 274 – 280 | NKLTMLD → VQDSLTY in isoform 3, isoform 4 and isoform 5. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 7 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019246 | 281 – 360 | Missing in isoform 3, isoform 4 and isoform 5. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 80 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | Z50749 mRNA Translation: CAA90626.1 AF067136 , AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA Translation: AAD26610.1 AF067136 , AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA Translation: AAD26611.1 AF067134 , AF067130, AF067131, AF067132, AF067133 Genomic DNA Translation: AAD26612.1 AF067134 , AF067132, AF067130, AF067133 Genomic DNA Translation: AAD26613.1 BT007296 mRNA Translation: AAP35960.1 BT020134 mRNA Translation: AAV38936.1 AK294043 mRNA Translation: BAG57395.1 AC005237 Genomic DNA No translation available. CH471063 Genomic DNA Translation: EAW71243.1 BC000910 mRNA Translation: AAH00910.1 BC012397 mRNA Translation: AAH12397.1 BC013001 mRNA Translation: AAH13001.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS2546.1 [Q15435-1] CCDS63190.1 [Q15435-5] CCDS63192.1 [Q15435-3] CCDS63193.1 [Q15435-4] CCDS63194.1 [Q15435-2] |
Protein sequence database of the Protein Information Resource More...PIRi | S68209 |
NCBI Reference Sequences More...RefSeqi | NP_001269338.1, NM_001282409.1 [Q15435-2] NP_001269339.1, NM_001282410.1 [Q15435-3] NP_001269340.1, NM_001282411.1 [Q15435-4] NP_001269341.1, NM_001282412.1 NP_001269342.1, NM_001282413.1 NP_001269343.1, NM_001282414.1 [Q15435-5] NP_002703.1, NM_002712.2 [Q15435-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.36587 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1] ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2] ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4] ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5] ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3] ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5510 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5510 |
UCSC genome browser More...UCSCi | uc002was.5 human [Q15435-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q15435 | Protein phosphatase 1, regulatory subunit 7, isoform CRA_b | 360 | |||
| Protein phosphatase 1 regulatory subunit 7 | 360 | ||||
| Protein phosphatase 1 regulatory subunit 7 | 360 | ||||
| UPI00093D5683 | 408 | ||||
| Protein phosphatase 1 regulatory subunit 7 | 376 | ||||
| +403 | |||||
| Q15435-2 | GH13488 | 328 | |||
| Uncharacterized protein | 330 | ||||
| UPI0008478FB6 | 330 | ||||
| Uncharacterized protein | 330 | ||||
| UPI000C6C3CCB | 330 | ||||
| +96 | |||||
| Q15435-4 | Uncharacterized protein | 280 | |||
| UPI0005335083 | 252 | ||||
| PPP1R7 isoform 13 | 237 | ||||
| PPP1R7 isoform 13 | 237 | ||||
| UPI0005F52712 | 237 | ||||
| +43 | |||||
| Q15435-5 | UPI0005F4313C | 221 | |||
| PPP1R7 isoform 2 | 221 | ||||
| Protein phosphatase 1 regulatory subunit 7 | 221 | ||||
| PPP1R7 isoform 2 | 221 | ||||
| Protein phosphatase 1 regulatory subunit 7 | 221 | ||||
| +4 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | Z50749 mRNA Translation: CAA90626.1 AF067136 , AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA Translation: AAD26610.1 AF067136 , AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA Translation: AAD26611.1 AF067134 , AF067130, AF067131, AF067132, AF067133 Genomic DNA Translation: AAD26612.1 AF067134 , AF067132, AF067130, AF067133 Genomic DNA Translation: AAD26613.1 BT007296 mRNA Translation: AAP35960.1 BT020134 mRNA Translation: AAV38936.1 AK294043 mRNA Translation: BAG57395.1 AC005237 Genomic DNA No translation available. CH471063 Genomic DNA Translation: EAW71243.1 BC000910 mRNA Translation: AAH00910.1 BC012397 mRNA Translation: AAH12397.1 BC013001 mRNA Translation: AAH13001.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS2546.1 [Q15435-1] CCDS63190.1 [Q15435-5] CCDS63192.1 [Q15435-3] CCDS63193.1 [Q15435-4] CCDS63194.1 [Q15435-2] |
Protein sequence database of the Protein Information Resource More...PIRi | S68209 |
NCBI Reference Sequences More...RefSeqi | NP_001269338.1, NM_001282409.1 [Q15435-2] NP_001269339.1, NM_001282410.1 [Q15435-3] NP_001269340.1, NM_001282411.1 [Q15435-4] NP_001269341.1, NM_001282412.1 NP_001269342.1, NM_001282413.1 NP_001269343.1, NM_001282414.1 [Q15435-5] NP_002703.1, NM_002712.2 [Q15435-1] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.36587 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | Q15435 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 111502, 60 interactors |
Database of interacting proteins More...DIPi | DIP-1005N |
Protein interaction database and analysis system More...IntActi | Q15435, 43 interactors |
Molecular INTeraction database More...MINTi | Q15435 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000234038 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | Q15435 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q15435 |
Polymorphism and mutation databases
Domain mapping of disease mutations (DMDM) More...DMDMi | 74762145 |
2D gel databases
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEi | IPI00033600 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | Q15435 |
MaxQB - The MaxQuant DataBase More...MaxQBi | Q15435 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q15435 |
PeptideAtlas More...PeptideAtlasi | Q15435 |
PRoteomics IDEntifications database More...PRIDEi | Q15435 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 60591 60592 [Q15435-2] 60593 [Q15435-3] 60594 [Q15435-4] |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 5510 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1] ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2] ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4] ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5] ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3] ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 5510 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:5510 |
UCSC genome browser More...UCSCi | uc002was.5 human [Q15435-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 5510 |
DisGeNET More...DisGeNETi | 5510 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000115685.14 |
GeneCards: human genes, protein and diseases More...GeneCardsi | PPP1R7 |
Human Gene Nomenclature Database More...HGNCi | HGNC:9295 PPP1R7 |
Human Protein Atlas More...HPAi | HPA034500 HPA034501 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602877 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_Q15435 |
Open Targets More...OpenTargetsi | ENSG00000115685 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA33658 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG0531 Eukaryota COG4886 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00900000140836 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000211189 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG082161 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q15435 |
KEGG Orthology (KO) More...KOi | K17550 |
Identification of Orthologs from Complete Genome Data More...OMAi | LFLRWNL |
Database of Orthologous Groups More...OrthoDBi | EOG091G0FWO |
Database for complete collections of gene phylogenies More...PhylomeDBi | Q15435 |
TreeFam database of animal gene trees More...TreeFami | TF105538 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | PPP1R7 human |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | PPP1R7 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 5510 |
Protein Ontology More...PROi | PR:Q15435 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000115685 |
CleanEx database of gene expression profiles More...CleanExi | HS_PPP1R7 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q15435 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q15435 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.80.10.10, 2 hits |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001611 Leu-rich_rpt IPR003591 Leu-rich_rpt_typical-subtyp IPR032675 LRR_dom_sf IPR003603 U2A'_phosphoprotein32A_C |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00369 LRR_TYP, 7 hits SM00446 LRRcap, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51450 LRR, 12 hits |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | PP1R7_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q15435Primary (citable) accession number: Q15435 Secondary accession number(s): B4DFD4 , B5MCY6, Q9UQE5, Q9UQE6, Q9Y6K4 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | June 13, 2006 |
| Last sequence update: | November 1, 1996 | |
| Last modified: | June 20, 2018 | |
| This is version 170 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families
