Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1 regulatory subunit 7

Gene

PPP1R7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of protein phosphatase 1.By similarity

GO - Molecular functioni

  • enzyme regulator activity Source: UniProtKB
  • protein phosphatase regulator activity Source: ProtInc

GO - Biological processi

  • positive regulation of protein dephosphorylation Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 7
Alternative name(s):
Protein phosphatase 1 regulatory subunit 22
Gene namesi
Name:PPP1R7
Synonyms:SDS22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000115685.14
HGNCiHGNC:9295 PPP1R7
MIMi602877 gene
neXtProtiNX_Q15435

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi148D → V: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi170F → A: Severely impaired the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi192E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi214F → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi280D → A: Severely impairs the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi300E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi302W → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi327Y → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1

Organism-specific databases

DisGeNETi5510
OpenTargetsiENSG00000115685
PharmGKBiPA33658

Polymorphism and mutation databases

DMDMi74762145

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002396132 – 360Protein phosphatase 1 regulatory subunit 7Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei24PhosphoserineCombined sources1
Modified residuei27PhosphoserineCombined sources1
Modified residuei44PhosphoserineCombined sources1
Modified residuei47PhosphoserineCombined sources1
Modified residuei322PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ15435
MaxQBiQ15435
PaxDbiQ15435
PeptideAtlasiQ15435
PRIDEiQ15435
ProteomicsDBi60591
60592 [Q15435-2]
60593 [Q15435-3]
60594 [Q15435-4]

2D gel databases

REPRODUCTION-2DPAGEiIPI00033600

PTM databases

iPTMnetiQ15435
PhosphoSitePlusiQ15435

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000115685 Expressed in 233 organ(s), highest expression level in testis
CleanExiHS_PPP1R7
ExpressionAtlasiQ15435 baseline and differential
GenevisibleiQ15435 HS

Organism-specific databases

HPAiHPA034500
HPA034501

Interactioni

Subunit structurei

Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi111502, 60 interactors
DIPiDIP-1005N
IntActiQ15435, 43 interactors
MINTiQ15435
STRINGi9606.ENSP00000234038

Structurei

3D structure databases

ProteinModelPortaliQ15435
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati77 – 98LRR 1Add BLAST22
Repeati99 – 120LRR 2Add BLAST22
Repeati121 – 142LRR 3Add BLAST22
Repeati143 – 164LRR 4Add BLAST22
Repeati165 – 186LRR 5Add BLAST22
Repeati187 – 208LRR 6Add BLAST22
Repeati209 – 230LRR 7Add BLAST22
Repeati231 – 252LRR 8Add BLAST22
Repeati253 – 274LRR 9Add BLAST22
Repeati275 – 296LRR 10Add BLAST22
Repeati297 – 318LRR 11Add BLAST22
Domaini331 – 360LRRCTAdd BLAST30

Sequence similaritiesi

Belongs to the SDS22 family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0531 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00930000150857
HOGENOMiHOG000211189
HOVERGENiHBG082161
InParanoidiQ15435
KOiK17550
OMAiLFLRWNL
OrthoDBiEOG091G0FWO
PhylomeDBiQ15435
TreeFamiTF105538

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR003603 U2A'_phosphoprotein32A_C
SMARTiView protein in SMART
SM00369 LRR_TYP, 7 hits
SM00446 LRRcap, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 12 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15435-1) [UniParc]FASTAAdd to basket
Also known as: sds22alpha1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD
60 70 80 90 100
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV
110 120 130 140 150
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS
160 170 180 190 200
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA
210 220 230 240 250
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN
260 270 280 290 300
LVNLRELYLS HNGIEVIEGL ENNNKLTMLD IASNRIKKIE NISHLTELQE
310 320 330 340 350
FWMNDNLLES WSDLDELKGA RSLETVYLER NPLQKDPQYR RKVMLALPSV
360
RQIDATFVRF
Length:360
Mass (Da):41,564
Last modified:November 1, 1996 - v1
Checksum:i49BCCF675EAA94D1
GO
Isoform 2 (identifier: Q15435-2) [UniParc]FASTAAdd to basket
Also known as: sds22alpha2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.

Show »
Length:317
Mass (Da):36,837
Checksum:i9AC120B3C729CF8B
GO
Isoform 3 (identifier: Q15435-3) [UniParc]FASTAAdd to basket
Also known as: sds22beta1

The sequence of this isoform differs from the canonical sequence as follows:
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:280
Mass (Da):32,053
Checksum:i4FE43AE30C65AB72
GO
Isoform 4 (identifier: Q15435-4) [UniParc]FASTAAdd to basket
Also known as: sds22beta2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:237
Mass (Da):27,326
Checksum:i627A59386B5763BB
GO
Isoform 5 (identifier: Q15435-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE → M
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:221
Mass (Da):25,593
Checksum:i9AB66B080F2F52C0
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MBZ8B5MBZ8_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
274Annotation score:
C9J177C9J177_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
289Annotation score:
C9JD73C9JD73_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
282Annotation score:
C9JRC4C9JRC4_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
184Annotation score:
H7C118H7C118_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
140Annotation score:
H7C003H7C003_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
335Annotation score:
H7C3Q5H7C3Q5_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R7
108Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0556721 – 60MAAER…EEDPE → M in isoform 5. CuratedAdd BLAST60
Alternative sequenceiVSP_01924418 – 60Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_019245274 – 280NKLTMLD → VQDSLTY in isoform 3, isoform 4 and isoform 5. 2 Publications7
Alternative sequenceiVSP_019246281 – 360Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST80

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50749 mRNA Translation: CAA90626.1
AF067136
, AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA Translation: AAD26610.1
AF067136
, AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA Translation: AAD26611.1
AF067134
, AF067130, AF067131, AF067132, AF067133 Genomic DNA Translation: AAD26612.1
AF067134
, AF067132, AF067130, AF067133 Genomic DNA Translation: AAD26613.1
BT007296 mRNA Translation: AAP35960.1
BT020134 mRNA Translation: AAV38936.1
AK294043 mRNA Translation: BAG57395.1
AC005237 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW71243.1
BC000910 mRNA Translation: AAH00910.1
BC012397 mRNA Translation: AAH12397.1
BC013001 mRNA Translation: AAH13001.1
CCDSiCCDS2546.1 [Q15435-1]
CCDS63190.1 [Q15435-5]
CCDS63192.1 [Q15435-3]
CCDS63193.1 [Q15435-4]
CCDS63194.1 [Q15435-2]
PIRiS68209
RefSeqiNP_001269338.1, NM_001282409.1 [Q15435-2]
NP_001269339.1, NM_001282410.1 [Q15435-3]
NP_001269340.1, NM_001282411.1 [Q15435-4]
NP_001269341.1, NM_001282412.1
NP_001269342.1, NM_001282413.1
NP_001269343.1, NM_001282414.1 [Q15435-5]
NP_002703.1, NM_002712.2 [Q15435-1]
UniGeneiHs.36587

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1]
GeneIDi5510
KEGGihsa:5510
UCSCiuc002was.5 human [Q15435-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50749 mRNA Translation: CAA90626.1
AF067136
, AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA Translation: AAD26610.1
AF067136
, AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA Translation: AAD26611.1
AF067134
, AF067130, AF067131, AF067132, AF067133 Genomic DNA Translation: AAD26612.1
AF067134
, AF067132, AF067130, AF067133 Genomic DNA Translation: AAD26613.1
BT007296 mRNA Translation: AAP35960.1
BT020134 mRNA Translation: AAV38936.1
AK294043 mRNA Translation: BAG57395.1
AC005237 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW71243.1
BC000910 mRNA Translation: AAH00910.1
BC012397 mRNA Translation: AAH12397.1
BC013001 mRNA Translation: AAH13001.1
CCDSiCCDS2546.1 [Q15435-1]
CCDS63190.1 [Q15435-5]
CCDS63192.1 [Q15435-3]
CCDS63193.1 [Q15435-4]
CCDS63194.1 [Q15435-2]
PIRiS68209
RefSeqiNP_001269338.1, NM_001282409.1 [Q15435-2]
NP_001269339.1, NM_001282410.1 [Q15435-3]
NP_001269340.1, NM_001282411.1 [Q15435-4]
NP_001269341.1, NM_001282412.1
NP_001269342.1, NM_001282413.1
NP_001269343.1, NM_001282414.1 [Q15435-5]
NP_002703.1, NM_002712.2 [Q15435-1]
UniGeneiHs.36587

3D structure databases

ProteinModelPortaliQ15435
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111502, 60 interactors
DIPiDIP-1005N
IntActiQ15435, 43 interactors
MINTiQ15435
STRINGi9606.ENSP00000234038

PTM databases

iPTMnetiQ15435
PhosphoSitePlusiQ15435

Polymorphism and mutation databases

DMDMi74762145

2D gel databases

REPRODUCTION-2DPAGEiIPI00033600

Proteomic databases

EPDiQ15435
MaxQBiQ15435
PaxDbiQ15435
PeptideAtlasiQ15435
PRIDEiQ15435
ProteomicsDBi60591
60592 [Q15435-2]
60593 [Q15435-3]
60594 [Q15435-4]

Protocols and materials databases

DNASUi5510
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685 [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685 [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685 [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685 [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685 [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685 [Q15435-1]
GeneIDi5510
KEGGihsa:5510
UCSCiuc002was.5 human [Q15435-1]

Organism-specific databases

CTDi5510
DisGeNETi5510
EuPathDBiHostDB:ENSG00000115685.14
GeneCardsiPPP1R7
HGNCiHGNC:9295 PPP1R7
HPAiHPA034500
HPA034501
MIMi602877 gene
neXtProtiNX_Q15435
OpenTargetsiENSG00000115685
PharmGKBiPA33658
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0531 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00930000150857
HOGENOMiHOG000211189
HOVERGENiHBG082161
InParanoidiQ15435
KOiK17550
OMAiLFLRWNL
OrthoDBiEOG091G0FWO
PhylomeDBiQ15435
TreeFamiTF105538

Miscellaneous databases

ChiTaRSiPPP1R7 human
GeneWikiiPPP1R7
GenomeRNAii5510
PROiPR:Q15435
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115685 Expressed in 233 organ(s), highest expression level in testis
CleanExiHS_PPP1R7
ExpressionAtlasiQ15435 baseline and differential
GenevisibleiQ15435 HS

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR003603 U2A'_phosphoprotein32A_C
SMARTiView protein in SMART
SM00369 LRR_TYP, 7 hits
SM00446 LRRcap, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 12 hits
ProtoNetiSearch...

Entry informationi

Entry nameiPP1R7_HUMAN
AccessioniPrimary (citable) accession number: Q15435
Secondary accession number(s): B4DFD4
, B5MCY6, Q9UQE5, Q9UQE6, Q9Y6K4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 173 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again