UniProtKB - Q15427 (SF3B4_HUMAN)

BLAST

>sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
FLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTF
SAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK
DSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPP
GSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGG
MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGS
PMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG
PLPQ

Align
Format
Add to basket Added to basket
History
Entry version 194 (07 Nov 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Splicing factor 3B subunit 4

Gene

SF3B4

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (PubMed:27720643). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937). May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well (PubMed:10882114). Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron (PubMed:15146077).4 Publications

GO - Molecular functionⁱ

RNA binding
Source: UniProtKB
Inferred from high throughput direct assayⁱ
- 22658674
- 22681889

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

mRNA processing
Source: ProtInc
Traceable author statementⁱ
- 7958871
mRNA splicing, via spliceosome Source: Reactome
positive regulation of mRNA splicing, via spliceosome
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
RNA splicing
Source: ProtInc
Traceable author statementⁱ
- 7958871
RNA splicing, via transesterification reactions
Source: ProtInc
Traceable author statementⁱ
- 7958871

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	RNA-binding
Biological process	mRNA processing, mRNA splicing

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway R-HSA-72165 mRNA Splicing - Minor Pathway

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Splicing factor 3B subunit 4 Alternative name(s): Pre-mRNA-splicing factor SF3b 49 kDa subunit Spliceosome-associated protein 49 Short name: SAP 49
Gene namesⁱ	Name:SF3B4 Synonyms:SAP49
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000143368.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:10771 SF3B4
MIMⁱ	605593 gene
neXtProtⁱ	NX_Q15427

Keywords - Cellular componentⁱ

Nucleus, Spliceosome

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Acrofacial dysostosis 1, Nager type (AFD1)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA form of acrofacial dysostosis, a group of disorders which are characterized by malformation of the craniofacial skeleton and the limbs. The major facial features of AFD1 include downslanted palpebral fissures, midface retrusion, and micrognathia, the latter of which often requires the placement of a tracheostomy in early childhood. Limb defects typically involve the anterior (radial) elements of the upper limbs and manifest as small or absent thumbs, triphalangeal thumbs, radial hyoplasia or aplasia, and radioulnar synostosis. Phocomelia of the upper limbs and, occasionally, lower-limb defects have also been reported.

Organism-specific databases

DisGeNET More...DisGeNETⁱ	10262
MalaCards human disease database More...MalaCardsⁱ	SF3B4
MIMⁱ	154400 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000143368
Orphanetⁱ	1788 Acrofacial dysostosis, Rodriguez type 245 Nager syndrome
PharmGKBⁱ	PA35689

Polymorphism and mutation databases

BioMutaⁱ	SF3B4
DMDMⁱ	2500587

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources1 Publication
ChainⁱPRO_0000081955	2 – 424	Splicing factor 3B subunit 4Add BLAST		423

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	2	N-acetylalanineCombined sources1 Publication		1
Modified residueⁱ	56	PhosphotyrosineCombined sources		1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	Q15427
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q15427
PaxDbⁱ	Q15427
PeptideAtlas More...PeptideAtlasⁱ	Q15427
PRIDEⁱ	Q15427
ProteomicsDBⁱ	60587

PTM databases

iPTMnetⁱ	Q15427
PhosphoSitePlusⁱ	Q15427
SwissPalmⁱ	Q15427

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000143368 Expressed in 203 organ(s), highest expression level in mucosa of transverse colon
CleanExⁱ	HS_SF3B4
ExpressionAtlasⁱ	Q15427 baseline and differential
Genevisibleⁱ	Q15427 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA028578 HPA064660

HPAⁱ

HPA028578
HPA064660

Interactionⁱ

Subunit structureⁱ

Component of splicing factor SF3B complex which is composed of at least eight subunits; SF3B1, SF3B2, SF3B3, SF3B4, SF3B5, SF3B6, PHF5A and DDX42 (PubMed:12234937, PubMed:12738865, PubMed:27720643, PubMed:28541300). SF3B associates with the splicing factor SF3A and a 12S RNA unit to form the U2 small nuclear ribonucleoproteins complex (U2 snRNP) (PubMed:12234937). Interacts directly with SF3B2. Found in a complex with PRMT9, SF3B2 and SF3B4 (PubMed:25737013). The SF3B complex composed of SF3B1, SF3B2, SF3B3, SF3B4, SF3B5, SF3B6 and PHF5A interacts with U2AF2 (PubMed:27720643). Component of the U11/U12 snRNPs that are part of the U12-type spliceosome (PubMed:15146077).6 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
BAG3	O95817	5	EBI-348469,EBI-747185
BAIAP2	Q9UQB8	3	EBI-348469,EBI-525456
BCAS2	O75934	2	EBI-348469,EBI-1050106
CWF19L2	Q2TBE0	5	EBI-348469,EBI-5453285
EFTUD2	Q15029	2	EBI-348469,EBI-357897
FKBP1A	Q0VDC6	3	EBI-348469,EBI-10226858
FRK	P42685	4	EBI-348469,EBI-1383583
GRB2	P62993	2	EBI-348469,EBI-401755
HNRNPUL1	Q9BUJ2	4	EBI-348469,EBI-1018153
HSPB7	Q9UBY9	3	EBI-348469,EBI-739361
MAPK9	P45984	6	EBI-348469,EBI-713568
METTL17	Q9H7H0	3	EBI-348469,EBI-749353
NCK2	O43639	6	EBI-348469,EBI-713635
NUB1	Q9Y5A7	3	EBI-348469,EBI-3936907
PPP1R16B	Q96T49	3	EBI-348469,EBI-10293968
PRPF8	Q6P2Q9	2	EBI-348469,EBI-538479
RBM10	P98175	7	EBI-348469,EBI-721525
RBM39	Q14498	3	EBI-348469,EBI-395290
SEC24D	O94855	3	EBI-348469,EBI-748817
SF3B2	E9PPJ0	3	EBI-348469,EBI-10177154
SF3B2	Q13435	5	EBI-348469,EBI-749111
SS18L1	O75177	4	EBI-348469,EBI-744674
TCAF1	Q9Y4C2	5	EBI-348469,EBI-750484
UBASH3A	P57075	3	EBI-348469,EBI-2105393
WDR83	Q9BRX9	2	EBI-348469,EBI-7705033
ZCCHC10	Q8TBK6	3	EBI-348469,EBI-597063

Protein-protein interaction databases

BioGridⁱ	115554, 173 interactors
CORUMⁱ	Q15427
IntActⁱ	Q15427, 62 interactors
Molecular INTeraction database More...MINTⁱ	Q15427
STRINGⁱ	9606.ENSP00000271628

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Turnⁱ	11 – 13	Combined sources	3
Beta strandⁱ	14 – 19	Combined sources	6
Helixⁱ	26 – 33	Combined sources	8
Turnⁱ	34 – 36	Combined sources	3
Beta strandⁱ	39 – 43	Combined sources	5
Turnⁱ	48 – 50	Combined sources	3
Beta strandⁱ	55 – 63	Combined sources	9
Helixⁱ	64 – 74	Combined sources	11
Beta strandⁱ	85 – 88	Combined sources	4
Beta strandⁱ	102 – 105	Combined sources	4
Helixⁱ	113 – 121	Combined sources	9
Beta strandⁱ	126 – 128	Combined sources	3
Turnⁱ	136 – 138	Combined sources	3
Beta strandⁱ	143 – 151	Combined sources	9
Helixⁱ	152 – 160	Combined sources	9
Turnⁱ	161 – 164	Combined sources	4
Beta strandⁱ	173 – 177	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	Q15427
SMRⁱ	Q15427
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q15427

EvolutionaryTraceⁱ

Q15427

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	13 – 91	RRM 1PROSITE-ProRule annotationAdd BLAST		79
Domainⁱ	100 – 179	RRM 2PROSITE-ProRule annotationAdd BLAST		80

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	215 – 218	Poly-Pro		4
Compositional biasⁱ	262 – 268	Poly-Pro		7

Sequence similaritiesⁱ

Belongs to the SF3B4 family.Curated

Keywords - Domainⁱ

Repeat

Phylogenomic databases

eggNOGⁱ	KOG0131 Eukaryota ENOG410XPT4 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00870000136537
HOGENOMⁱ	HOG000200535
HOVERGENⁱ	HBG002295
InParanoidⁱ	Q15427
KEGG Orthology (KO) More...KOⁱ	K12831
OMAⁱ	PNAWAPP
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0HAI
PhylomeDBⁱ	Q15427
TreeFamⁱ	TF300890

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd12334 RRM1_SF3B4, 1 hit cd12335 RRM2_SF3B4, 1 hit
Gene3Dⁱ	3.30.70.330, 2 hits
InterProⁱ	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR000504 RRM_dom IPR034158 SF3B4_RRM1 IPR034159 SF3B4_RRM2
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00076 RRM_1, 2 hits
SMARTⁱ	View protein in SMART SM00360 RRM, 2 hits
SUPFAMⁱ	SSF54928 SSF54928, 1 hit
PROSITEⁱ	View protein in PROSITE PS50102 RRM, 2 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

Q15427-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAAGPISERN QDATVYVGGL DEKVSEPLLW ELFLQAGPVV NTHMPKDRVT 
        60         70         80         90        100
GQHQGYGFVE FLSEEDADYA IKIMNMIKLY GKPIRVNKAS AHNKNLDVGA 
       110        120        130        140        150
NIFIGNLDPE IDEKLLYDTF SAFGVILQTP KIMRDPDTGN SKGYAFINFA 
       160        170        180        190        200
SFDASDAAIE AMNGQYLCNR PITVSYAFKK DSKGERHGSA AERLLAAQNP 
       210        220        230        240        250
LSQADRPHQL FADAPPPPSA PNPVVSSLGS GLPPPGMPPP GSFPPPVPPP 
       260        270        280        290        300
GALPPGIPPA MPPPPMPPGA AGHGPPSAGT PGAGHPGHGH SHPHPFPPGG 
       310        320        330        340        350
MPHPGMSQMQ LAHHGPHGLG HPHAGPPGSG GQPPPRPPPG MPHPGPPPMG 
       360        370        380        390        400
MPPRGPPFGS PMGHPGPMPP HGMRGPPPLM PPHGYTGPPR PPPYGYQRGP 
       410        420 
LPPPRPTPRP PVPPRGPLRG PLPQ

Length:424

Mass (Da):44,386

Last modified:November 1, 1996 - v1

Checksum:ⁱ212472A25D3FF002

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	Q5SZ64	Q5SZ64_HUMAN		Splicing factor 3B subunit 4 Splicing factor 3B subunit 4 (Splicing factor 3b, subunit 4, 49kDa)	SF3B4 RP11-196G18.20-002	190	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L35013 Genomic DNA Translation: AAA60300.1 AL591493, AL590487 Genomic DNA Translation: CAI12554.1 AL590487, AL591493 Genomic DNA Translation: CAI12648.1 CH471121 Genomic DNA Translation: EAW53595.1 BC004273 mRNA Translation: AAH04273.1 BC013886 mRNA Translation: AAH13886.1 BC090883 mRNA Translation: AAH90883.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS72900.1
PIRⁱ	A54964
NCBI Reference Sequences More...RefSeqⁱ	NP_005841.1, NM_005850.4
UniGeneⁱ	Hs.516160

Genome annotation databases

Ensemblⁱ	ENST00000271628; ENSP00000271628; ENSG00000143368
GeneIDⁱ	10262
KEGGⁱ	hsa:10262
UCSC genome browser More...UCSCⁱ	uc001etk.3 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q15427	SF3B4 isoform 1		PANTR		424	UniRef100_Q15427
Splicing factor 3B subunit 4		MACMU		424
Splicing factor 3b subunit 4		MACFA		424
Uncharacterized protein		COLAP		424
splicing factor 3B subunit 4		TARSY		424
+11

Protein	Similar proteins		Species	Score	Length	Source
Q15427	Splicing factor 3B subunit 4		MOUSE		424	UniRef90_Q15427
Splicing factor 3B subunit 4		RAT		424
SF3B4 isoform 1		PANTR		424
Splicing factor 3B subunit 4		MACMU		424
Splicing factor 3b subunit 4		MACFA		424
+87

Protein	Similar proteins		Species	Score	Length	Source
Q15427	Splicing factor 3B subunit 4		MOUSE		424	UniRef50_Q15427
Splicing factor 3B subunit 4		RAT		424
SF3B4 isoform 1		PANTR		424
Splicing factor 3B subunit 4		MACMU		424
Splicing factor 3b subunit 4		MACFA		424
+236

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L35013 Genomic DNA Translation: AAA60300.1 AL591493, AL590487 Genomic DNA Translation: CAI12554.1 AL590487, AL591493 Genomic DNA Translation: CAI12648.1 CH471121 Genomic DNA Translation: EAW53595.1 BC004273 mRNA Translation: AAH04273.1 BC013886 mRNA Translation: AAH13886.1 BC090883 mRNA Translation: AAH90883.1
CCDSⁱ	CCDS72900.1
PIRⁱ	A54964
RefSeqⁱ	NP_005841.1, NM_005850.4
UniGeneⁱ	Hs.516160

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1X5T	NMR	-	A	102-184	[»]
	5GVQ	NMR	-	A	5-96	[»]
	5Z56	electron microscopy	5.10	4	1-424	[»]
	5Z57	electron microscopy	6.50	4	1-424	[»]
	5Z58	electron microscopy	4.90	4	1-424	[»]
ProteinModelPortalⁱ	Q15427
SMRⁱ	Q15427
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	115554, 173 interactors
CORUMⁱ	Q15427
IntActⁱ	Q15427, 62 interactors
MINTⁱ	Q15427
STRINGⁱ	9606.ENSP00000271628

PTM databases

iPTMnetⁱ	Q15427
PhosphoSitePlusⁱ	Q15427
SwissPalmⁱ	Q15427

Polymorphism and mutation databases

BioMutaⁱ	SF3B4
DMDMⁱ	2500587

Proteomic databases

EPDⁱ	Q15427
MaxQBⁱ	Q15427
PaxDbⁱ	Q15427
PeptideAtlasⁱ	Q15427
PRIDEⁱ	Q15427
ProteomicsDBⁱ	60587

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	10262
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000271628; ENSP00000271628; ENSG00000143368
GeneIDⁱ	10262
KEGGⁱ	hsa:10262
UCSCⁱ	uc001etk.3 human

Organism-specific databases

CTDⁱ	10262
DisGeNETⁱ	10262
EuPathDBⁱ	HostDB:ENSG00000143368.9
GeneCardsⁱ	SF3B4
HGNCⁱ	HGNC:10771 SF3B4
HPAⁱ	HPA028578 HPA064660
MalaCardsⁱ	SF3B4
MIMⁱ	154400 phenotype 605593 gene
neXtProtⁱ	NX_Q15427
OpenTargetsⁱ	ENSG00000143368
Orphanetⁱ	1788 Acrofacial dysostosis, Rodriguez type 245 Nager syndrome
PharmGKBⁱ	PA35689
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0131 Eukaryota ENOG410XPT4 LUCA
GeneTreeⁱ	ENSGT00870000136537
HOGENOMⁱ	HOG000200535
HOVERGENⁱ	HBG002295
InParanoidⁱ	Q15427
KOⁱ	K12831
OMAⁱ	PNAWAPP
OrthoDBⁱ	EOG091G0HAI
PhylomeDBⁱ	Q15427
TreeFamⁱ	TF300890

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway R-HSA-72165 mRNA Splicing - Minor Pathway

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72165 mRNA Splicing - Minor Pathway

Miscellaneous databases

ChiTaRSⁱ	SF3B4 human
EvolutionaryTraceⁱ	Q15427
GeneWikiⁱ	SF3B4
GenomeRNAiⁱ	10262
Protein Ontology More...PROⁱ	PR:Q15427
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000143368 Expressed in 203 organ(s), highest expression level in mucosa of transverse colon
CleanExⁱ	HS_SF3B4
ExpressionAtlasⁱ	Q15427 baseline and differential
Genevisibleⁱ	Q15427 HS

Family and domain databases

CDDⁱ	cd12334 RRM1_SF3B4, 1 hit cd12335 RRM2_SF3B4, 1 hit
Gene3Dⁱ	3.30.70.330, 2 hits
InterProⁱ	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR000504 RRM_dom IPR034158 SF3B4_RRM1 IPR034159 SF3B4_RRM2
Pfamⁱ	View protein in Pfam PF00076 RRM_1, 2 hits
SMARTⁱ	View protein in SMART SM00360 RRM, 2 hits
SUPFAMⁱ	SSF54928 SSF54928, 1 hit
PROSITEⁱ	View protein in PROSITE PS50102 RRM, 2 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SF3B4_HUMAN
Accessionⁱ	Q15427Primary (citable) accession number: Q15427 Secondary accession number(s): Q5SZ63
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	November 1, 1996
	Last modified:	November 7, 2018
	This is version 194 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q15427 (SF3B4_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Splicing factor 3B subunit 4

SF3B4

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ