Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Elongin-B

Gene

ELOB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).By similarity1 Publication
The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.4 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243 Tat-mediated HIV elongation arrest and recovery
R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287 HIV elongation arrest and recovery
R-HSA-167290 Pausing and recovery of HIV elongation
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955 RNA Polymerase II Transcription Elongation
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Elongin-B
Short name:
EloB
Alternative name(s):
Elongin 18 kDa subunit
RNA polymerase II transcription factor SIII subunit B
SIII p18
Transcription elongation factor B polypeptide 2
Gene namesi
Name:ELOBImported
Synonyms:TCEB2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000103363.14
HGNCiHGNC:11619 ELOB
MIMi600787 gene
neXtProtiNX_Q15370

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi6923
OpenTargetsiENSG00000103363
PharmGKBiPA36378

Chemistry databases

ChEMBLiCHEMBL3301400

Polymorphism and mutation databases

BioMutaiTCEB2
DMDMi32699512

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001149141 – 118Elongin-BAdd BLAST118

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei84PhosphothreonineBy similarity1
Modified residuei108PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ15370
MaxQBiQ15370
PaxDbiQ15370
PeptideAtlasiQ15370
PRIDEiQ15370
ProteomicsDBi60548
TopDownProteomicsiQ15370-1 [Q15370-1]
Q15370-2 [Q15370-2]

PTM databases

iPTMnetiQ15370
PhosphoSitePlusiQ15370

Expressioni

Gene expression databases

BgeeiENSG00000103363 Expressed in 235 organ(s), highest expression level in left testis
CleanExiHS_TCEB2
ExpressionAtlasiQ15370 baseline and differential
GenevisibleiQ15370 HS

Interactioni

Subunit structurei

Heterotrimer of an A (ELOA, ELOA2 or ELOA3), ELOB and ELOC subunit (PubMed:10205047, PubMed:17997974). The elongin BC complex interacts with EPOP; leading to recruit the elongin BC complex to Polycomb group (PcG) target genes, thereby restricting excessive activity of the PRC2/EED-EZH2 complex (By similarity). Part of E3 ubiquitin ligase complexes with CUL5 or CUL2, RBX1 and a substrate adapter protein that can be either SOCS1, SOCS5, ELOA, VHL or WSB1 (PubMed:15590694, PubMed:22286099). Interacts with VHL (PubMed:10205047, PubMed:11006129). Found in a complex composed of LIMD1, VHL, EGLN1/PHD2, ELOB and CUL2. Interacts with SPSB1 (PubMed:17189197). Interacts with KLHDC10; which may be an E3 ubiquitin ligase complex substrate recognition component (PubMed:23102700).By similarity7 Publications
(Microbial infection) Substrate adapter protein can be a viral protein such as HIV Vif.1 Publication
(Microbial infection) Interacts with molluscum contagiosum virus MC132.1 Publication
(Microbial infection) Interacts with herpes virus 8 virus protein LANA1.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112785, 126 interactors
CORUMiQ15370
DIPiDIP-29570N
IntActiQ15370, 59 interactors
MINTiQ15370
STRINGi9606.ENSP00000262306

Chemistry databases

BindingDBiQ15370

Structurei

Secondary structure

1118
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ15370
SMRiQ15370
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15370

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 66Ubiquitin-likePROSITE-ProRule annotationAdd BLAST66

Phylogenomic databases

eggNOGiKOG4495 Eukaryota
ENOG4111UGJ LUCA
GeneTreeiENSGT00390000018316
HOGENOMiHOG000293425
HOVERGENiHBG008581
InParanoidiQ15370
KOiK03873
OrthoDBiEOG091G10A8
PhylomeDBiQ15370
TreeFamiTF325964

Family and domain databases

InterProiView protein in InterPro
IPR039049 ELOB
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PANTHERiPTHR13248 PTHR13248, 1 hit
PfamiView protein in Pfam
PF00240 ubiquitin, 1 hit
SMARTiView protein in SMART
SM00213 UBQ, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50053 UBIQUITIN_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15370-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVFLMIRRH KTTIFTDAKE SSTVFELKRI VEGILKRPPD EQRLYKDDQL
60 70 80 90 100
LDDGKTLGEC GFTSQTARPQ APATVGLAFR ADDTFEALCI EPFSSPPELP
110
DVMKPQDSGS SANEQAVQ
Length:118
Mass (Da):13,133
Last modified:November 1, 1996 - v1
Checksum:iC045F58FBED0EC47
GO
Isoform 2 (identifier: Q15370-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-118: Q → HLHVHSQTMAKSRNTSWSQCPGLTACSTREPQDGPTQVHPRWGL

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):17,911
Checksum:i72277A4ACF21429F
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZU8B8ZZU8_HUMAN
Elongin-B
ELOB TCEB2, hCG_1778969
113Annotation score:
I3L0M9I3L0M9_HUMAN
Elongin-B
ELOB
140Annotation score:
A0A0B4J296A0A0B4J296_HUMAN
Elongin-B
ELOB
66Annotation score:

Sequence cautioni

The sequence AAC08452 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045784118Q → HLHVHSQTMAKSRNTSWSQC PGLTACSTREPQDGPTQVHP RWGL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42856 mRNA Translation: AAA75522.1
BM700019 mRNA No translation available.
AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems.
AC092117 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85472.1
CH471112 Genomic DNA Translation: EAW85474.1
BC013306 mRNA Translation: AAH13306.1
BC065000 mRNA Translation: AAH65000.1
CCDSiCCDS32374.1 [Q15370-2]
CCDS45387.1 [Q15370-1]
PIRiI59405
RefSeqiNP_009039.1, NM_007108.3 [Q15370-1]
NP_996896.1, NM_207013.2 [Q15370-2]
UniGeneiHs.172772

Genome annotation databases

EnsembliENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2]
ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]
GeneIDi6923
KEGGihsa:6923
UCSCiuc002crm.4 human [Q15370-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42856 mRNA Translation: AAA75522.1
BM700019 mRNA No translation available.
AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems.
AC092117 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85472.1
CH471112 Genomic DNA Translation: EAW85474.1
BC013306 mRNA Translation: AAH13306.1
BC065000 mRNA Translation: AAH65000.1
CCDSiCCDS32374.1 [Q15370-2]
CCDS45387.1 [Q15370-1]
PIRiI59405
RefSeqiNP_009039.1, NM_007108.3 [Q15370-1]
NP_996896.1, NM_207013.2 [Q15370-2]
UniGeneiHs.172772

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LM8X-ray1.85B1-118[»]
1LQBX-ray2.00A1-118[»]
1VCBX-ray2.70A/D/G/J1-118[»]
2C9WX-ray1.90B1-118[»]
2IZVX-ray2.55B1-118[»]
2JZ3NMR-B1-118[»]
2MA9NMR-B1-118[»]
3DCGX-ray2.40A/C1-118[»]
3ZKJX-ray2.58C/F1-118[»]
3ZNGX-ray2.85C/F1-118[»]
3ZRCX-ray2.90A/D/G/J1-118[»]
3ZRFX-ray2.80A/D/G/J1-118[»]
3ZTCX-ray2.65A/D/G/J1-118[»]
3ZTDX-ray2.79A/D/G/J1-118[»]
3ZUNX-ray2.50A/D/G/J1-118[»]
4AJYX-ray1.73B1-118[»]
4AWJX-ray2.50A/D/G/J1-104[»]
4B95X-ray2.80A/D/G/J1-118[»]
4B9KX-ray2.00A/D/G/J1-104[»]
4BKSX-ray2.20A/D/G/J1-104[»]
4BKTX-ray2.35A/D/G/J1-104[»]
4N9FX-ray3.304/D/H/J/P/W/X/e/g/m/s/y1-102[»]
4W9CX-ray2.20A/D/G/J1-104[»]
4W9DX-ray2.20A/D/G/J1-104[»]
4W9EX-ray2.60A/D/G/J1-104[»]
4W9FX-ray2.10A/D/G/J1-104[»]
4W9GX-ray2.70A/D/G/J1-104[»]
4W9HX-ray2.10A/D/G/J1-104[»]
4W9IX-ray2.40A/D/G/J1-104[»]
4W9JX-ray2.20A/D/G/J1-104[»]
4W9KX-ray2.10A/D/G/J1-104[»]
4W9LX-ray2.20A/D/G/J1-104[»]
4WQOX-ray3.20B1-118[»]
5BO4X-ray2.90B/E/H/K/N/Q1-104[»]
5LLIX-ray2.40A/D/G/J1-104[»]
5N4WX-ray3.90B1-104[»]
5NVVX-ray2.10A/D/G/J1-104[»]
5NVWX-ray2.20A/D/G/J1-104[»]
5NVXX-ray2.20A/D/G/J1-104[»]
5NVYX-ray2.90A/D/G/J1-104[»]
5NVZX-ray2.70A/D/G/J1-104[»]
5NW0X-ray2.30A/D/G/J1-104[»]
5NW1X-ray2.10A/D/G/J1-104[»]
5NW2X-ray2.20A/D/G/J1-104[»]
5T35X-ray2.70B/F1-104[»]
6BVBX-ray2.00B1-118[»]
6C5XX-ray3.10B/E1-118[»]
6FMIX-ray2.80A/D1-104[»]
6FMJX-ray2.45A/D/G/J1-104[»]
6FMKX-ray2.75A/D/G/J1-104[»]
6GFXX-ray1.83A1-104[»]
6GFYX-ray2.70A/D/G/J1-104[»]
6GFZX-ray2.30A/D/G/J1-104[»]
6GMNX-ray1.94A/D/G/J1-104[»]
6GMQX-ray2.75A/D/G/J1-104[»]
6GMRX-ray1.75B1-118[»]
6GMXX-ray2.53A/D/G/J1-104[»]
ProteinModelPortaliQ15370
SMRiQ15370
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112785, 126 interactors
CORUMiQ15370
DIPiDIP-29570N
IntActiQ15370, 59 interactors
MINTiQ15370
STRINGi9606.ENSP00000262306

Chemistry databases

BindingDBiQ15370
ChEMBLiCHEMBL3301400

PTM databases

iPTMnetiQ15370
PhosphoSitePlusiQ15370

Polymorphism and mutation databases

BioMutaiTCEB2
DMDMi32699512

Proteomic databases

EPDiQ15370
MaxQBiQ15370
PaxDbiQ15370
PeptideAtlasiQ15370
PRIDEiQ15370
ProteomicsDBi60548
TopDownProteomicsiQ15370-1 [Q15370-1]
Q15370-2 [Q15370-2]

Protocols and materials databases

DNASUi6923
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2]
ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]
GeneIDi6923
KEGGihsa:6923
UCSCiuc002crm.4 human [Q15370-1]

Organism-specific databases

CTDi6923
DisGeNETi6923
EuPathDBiHostDB:ENSG00000103363.14
GeneCardsiELOB
HGNCiHGNC:11619 ELOB
MIMi600787 gene
neXtProtiNX_Q15370
OpenTargetsiENSG00000103363
PharmGKBiPA36378
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4495 Eukaryota
ENOG4111UGJ LUCA
GeneTreeiENSGT00390000018316
HOGENOMiHOG000293425
HOVERGENiHBG008581
InParanoidiQ15370
KOiK03873
OrthoDBiEOG091G10A8
PhylomeDBiQ15370
TreeFamiTF325964

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243 Tat-mediated HIV elongation arrest and recovery
R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287 HIV elongation arrest and recovery
R-HSA-167290 Pausing and recovery of HIV elongation
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955 RNA Polymerase II Transcription Elongation
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

EvolutionaryTraceiQ15370
GeneWikiiTCEB2
GenomeRNAii6923
PROiPR:Q15370
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000103363 Expressed in 235 organ(s), highest expression level in left testis
CleanExiHS_TCEB2
ExpressionAtlasiQ15370 baseline and differential
GenevisibleiQ15370 HS

Family and domain databases

InterProiView protein in InterPro
IPR039049 ELOB
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PANTHERiPTHR13248 PTHR13248, 1 hit
PfamiView protein in Pfam
PF00240 ubiquitin, 1 hit
SMARTiView protein in SMART
SM00213 UBQ, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50053 UBIQUITIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiELOB_HUMAN
AccessioniPrimary (citable) accession number: Q15370
Secondary accession number(s): B7WPD3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2003
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 190 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again