Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15370 (ELOB_HUMAN)

Entry version 208 (02 Jun 2021)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Elongin-B

Gene

ELOB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163).

In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).

By similarity1 Publication

The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.

4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHost-virus interaction, Transcription, Transcription regulation, Ubl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q15370

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-112382, Formation of RNA Pol II elongation complex
R-HSA-1234176, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152, Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200, Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238, Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243, Tat-mediated HIV elongation arrest and recovery
R-HSA-167246, Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287, HIV elongation arrest and recovery
R-HSA-167290, Pausing and recovery of HIV elongation
R-HSA-180585, Vif-mediated degradation of APOBEC3G
R-HSA-674695, RNA Polymerase II Pre-transcription Events
R-HSA-6796648, TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955, RNA Polymerase II Transcription Elongation
R-HSA-8951664, Neddylation
R-HSA-9010553, Regulation of expression of SLITs and ROBOs
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Elongin-B
Short name:
EloB
Alternative name(s):
Elongin 18 kDa subunit
RNA polymerase II transcription factor SIII subunit B
SIII p18
Transcription elongation factor B polypeptide 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ELOBImported
Synonyms:TCEB2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11619, ELOB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600787, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15370

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000103363.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		6923

Open Targets

More...OpenTargetsi		ENSG00000103363

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36378

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15370, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3301400
CHEMBL4296117

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ELOB

Domain mapping of disease mutations (DMDM)

More...DMDMi		32699512

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001149141 – 118Elongin-BAdd BLAST118

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei84PhosphothreonineBy similarity1
Modified residuei108PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15370

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15370

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15370

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15370

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15370

PeptideAtlas

More...PeptideAtlasi		Q15370

PRoteomics IDEntifications database

More...PRIDEi		Q15370

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60548 [Q15370-1]
6294

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q15370-1 [Q15370-1]
Q15370-2 [Q15370-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15370

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q15370

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15370

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q15370

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000103363, Expressed in left testis and 251 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15370, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15370, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000103363, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotrimer of an A (ELOA, ELOA2 or ELOA3P), ELOB and ELOC subunit (PubMed:10205047, PubMed:17997974). The elongin BC complex interacts with EPOP; leading to recruit the elongin BC complex to Polycomb group (PcG) target genes, thereby restricting excessive activity of the PRC2/EED-EZH2 complex (By similarity). Part of E3 ubiquitin ligase complexes with CUL5 or CUL2, RBX1 and a substrate adapter protein that can be either SOCS1, SOCS5, ELOA, VHL or WSB1 (PubMed:15590694, PubMed:22286099).

Interacts with VHL (PubMed:10205047, PubMed:11006129).

Found in a complex composed of LIMD1, VHL, EGLN1/PHD2, ELOB and CUL2.

Interacts with SPSB1 (PubMed:17189197).

Interacts with KLHDC10; which may be an E3 ubiquitin ligase complex substrate recognition component (PubMed:23102700). May also interact with DCUN1D1, DCUN1D2, DCUN1D3 and DCUN1D5 (PubMed:26906416).

By similarity8 Publications

(Microbial infection) Substrate adapter protein can be a viral protein such as HIV Vif.

1 Publication

(Microbial infection) Interacts with molluscum contagiosum virus MC132.

1 Publication

(Microbial infection) Interacts with herpes virus 8 virus protein LANA1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112785, 243 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q15370

Database of interacting proteins

More...DIPi		DIP-29570N

Protein interaction database and analysis system

More...IntActi		Q15370, 90 interactors

Molecular INTeraction database

More...MINTi		Q15370

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000262306

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q15370

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q15370, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1118
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q15370

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15370

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q15370

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 66Ubiquitin-likePROSITE-ProRule annotationAdd BLAST66

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni92 – 118DisorderedSequence analysisAdd BLAST27

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4495, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000018316

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_139243_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15370

Database of Orthologous Groups

More...OrthoDBi		1338040at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15370

TreeFam database of animal gene trees

More...TreeFami		TF325964

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039049, ELOB
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf

The PANTHER Classification System

More...PANTHERi		PTHR13248, PTHR13248, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00240, ubiquitin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00213, UBQ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50053, UBIQUITIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15370-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVFLMIRRH KTTIFTDAKE SSTVFELKRI VEGILKRPPD EQRLYKDDQL 
        60         70         80         90        100
LDDGKTLGEC GFTSQTARPQ APATVGLAFR ADDTFEALCI EPFSSPPELP 
       110 
DVMKPQDSGS SANEQAVQ
Length:118
Mass (Da):13,133
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC045F58FBED0EC47
GO
Isoform 2 (identifier: Q15370-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-118: Q → HLHVHSQTMAKSRNTSWSQCPGLTACSTREPQDGPTQVHPRWGL

Show »
Length:161
Mass (Da):17,911
Checksum:i72277A4ACF21429F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZU8B8ZZU8_HUMAN
Elongin-B
ELOB TCEB2, hCG_1778969
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0M9I3L0M9_HUMAN
Elongin-B
ELOB
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J296A0A0B4J296_HUMAN
Elongin-B
ELOB
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC08452 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045784118Q → HLHVHSQTMAKSRNTSWSQC PGLTACSTREPQDGPTQVHP RWGL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L42856 mRNA Translation: AAA75522.1
BM700019 mRNA No translation available.
AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems.
AC092117 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85472.1
CH471112 Genomic DNA Translation: EAW85474.1
BC013306 mRNA Translation: AAH13306.1
BC065000 mRNA Translation: AAH65000.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32374.1 [Q15370-2]
CCDS45387.1 [Q15370-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I59405

NCBI Reference Sequences

More...RefSeqi		NP_009039.1, NM_007108.3 [Q15370-1]
NP_996896.1, NM_207013.2 [Q15370-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2]
ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6923

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6923

UCSC genome browser

More...UCSCi		uc002crm.4, human [Q15370-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42856 mRNA Translation: AAA75522.1
BM700019 mRNA No translation available.
AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems.
AC092117 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85472.1
CH471112 Genomic DNA Translation: EAW85474.1
BC013306 mRNA Translation: AAH13306.1
BC065000 mRNA Translation: AAH65000.1
CCDSiCCDS32374.1 [Q15370-2]
CCDS45387.1 [Q15370-1]
PIRiI59405
RefSeqiNP_009039.1, NM_007108.3 [Q15370-1]
NP_996896.1, NM_207013.2 [Q15370-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LM8X-ray1.85B1-118[»]
1LQBX-ray2.00A1-118[»]
1VCBX-ray2.70A/D/G/J1-118[»]
2C9WX-ray1.90B1-118[»]
2IZVX-ray2.55B1-118[»]
2JZ3NMR-B1-118[»]
2MA9NMR-B1-118[»]
3DCGX-ray2.40A/C1-118[»]
3ZKJX-ray2.58C/F1-118[»]
3ZNGX-ray2.85C/F1-118[»]
3ZRCX-ray2.90A/D/G/J1-118[»]
3ZRFX-ray2.80A/D/G/J1-118[»]
3ZTCX-ray2.65A/D/G/J1-118[»]
3ZTDX-ray2.79A/D/G/J1-118[»]
3ZUNX-ray2.50A/D/G/J1-118[»]
4AJYX-ray1.73B1-118[»]
4AWJX-ray2.50A/D/G/J1-104[»]
4B95X-ray2.80A/D/G/J1-118[»]
4B9KX-ray2.00A/D/G/J1-104[»]
4BKSX-ray2.20A/D/G/J1-104[»]
4BKTX-ray2.35A/D/G/J1-104[»]
4N9FX-ray3.304/D/H/J/P/W/X/e/g/m/s/y1-102[»]
4W9CX-ray2.20A/D/G/J1-104[»]
4W9DX-ray2.20A/D/G/J1-104[»]
4W9EX-ray2.60A/D/G/J1-104[»]
4W9FX-ray2.10A/D/G/J1-104[»]
4W9GX-ray2.70A/D/G/J1-104[»]
4W9HX-ray2.10A/D/G/J1-104[»]
4W9IX-ray2.40A/D/G/J1-104[»]
4W9JX-ray2.20A/D/G/J1-104[»]
4W9KX-ray2.10A/D/G/J1-104[»]
4W9LX-ray2.20A/D/G/J1-104[»]
4WQOX-ray3.20B1-118[»]
5BO4X-ray2.90B/E/H/K/N/Q1-104[»]
5LLIX-ray2.40A/D/G/J1-104[»]
5N4WX-ray3.90B1-104[»]
5NVVX-ray2.10A/D/G/J1-104[»]
5NVWX-ray2.20A/D/G/J1-104[»]
5NVXX-ray2.20A/D/G/J1-104[»]
5NVYX-ray2.90A/D/G/J1-104[»]
5NVZX-ray2.70A/D/G/J1-104[»]
5NW0X-ray2.30A/D/G/J1-104[»]
5NW1X-ray2.10A/D/G/J1-104[»]
5NW2X-ray2.20A/D/G/J1-104[»]
5T35X-ray2.70B/F1-104[»]
6BVBX-ray2.00B1-118[»]
6C5XX-ray3.10B/E1-118[»]
6FMIX-ray2.80A/D1-104[»]
6FMJX-ray2.45A/D/G/J1-104[»]
6FMKX-ray2.75A/D/G/J1-104[»]
6GFXX-ray1.83A1-104[»]
6GFYX-ray2.70A/D/G/J1-104[»]
6GFZX-ray2.30A/D/G/J1-104[»]
6GMNX-ray1.94A/D/G/J1-104[»]
6GMQX-ray2.75A/D/G/J1-104[»]
6GMRX-ray1.75B1-118[»]
6GMXX-ray2.53A/D/G/J1-104[»]
6HAXX-ray2.35D/H1-104[»]
6HAYX-ray2.24D/H1-104[»]
6HR2X-ray1.76D/H1-104[»]
6I4XX-ray2.69B1-104[»]
6I5JX-ray2.80B/E1-104[»]
6I5NX-ray1.98B/E1-104[»]
6I7QX-ray1.80B1-118[»]
6I7RX-ray1.95B1-118[»]
6P59X-ray2.94D/W1-118[»]
6R6Helectron microscopy8.40P1-104[»]
6R7Felectron microscopy8.20P1-118[»]
6R7Helectron microscopy8.80P1-104[»]
6R7Ielectron microscopy5.90P1-106[»]
6R7Nelectron microscopy6.50P1-104[»]
6SISX-ray3.50B/F1-104[»]
6V9Helectron microscopy4.10E1-118[»]
6ZHCX-ray1.92BBB1-107[»]
7KHHX-ray2.28A1-118[»]
BMRBiQ15370
SMRiQ15370
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112785, 243 interactors
CORUMiQ15370
DIPiDIP-29570N
IntActiQ15370, 90 interactors
MINTiQ15370
STRINGi9606.ENSP00000262306

Chemistry databases

BindingDBiQ15370
ChEMBLiCHEMBL3301400
CHEMBL4296117

PTM databases

iPTMnetiQ15370
MetOSiteiQ15370
PhosphoSitePlusiQ15370
SwissPalmiQ15370

Genetic variation databases

BioMutaiELOB
DMDMi32699512

Proteomic databases

EPDiQ15370
jPOSTiQ15370
MassIVEiQ15370
MaxQBiQ15370
PaxDbiQ15370
PeptideAtlasiQ15370
PRIDEiQ15370
ProteomicsDBi60548 [Q15370-1]
6294
TopDownProteomicsiQ15370-1 [Q15370-1]
Q15370-2 [Q15370-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		23893, 329 antibodies

The DNASU plasmid repository

More...DNASUi		6923

Genome annotation databases

EnsembliENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2]
ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]
GeneIDi6923
KEGGihsa:6923
UCSCiuc002crm.4, human [Q15370-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6923
DisGeNETi6923

GeneCards: human genes, protein and diseases

More...GeneCardsi		ELOB
HGNCiHGNC:11619, ELOB
HPAiENSG00000103363, Low tissue specificity
MIMi600787, gene
neXtProtiNX_Q15370
OpenTargetsiENSG00000103363
PharmGKBiPA36378
VEuPathDBiHostDB:ENSG00000103363.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4495, Eukaryota
GeneTreeiENSGT00390000018316
HOGENOMiCLU_139243_1_0_1
InParanoidiQ15370
OrthoDBi1338040at2759
PhylomeDBiQ15370
TreeFamiTF325964

Enzyme and pathway databases

UniPathwayiUPA00143
PathwayCommonsiQ15370
ReactomeiR-HSA-112382, Formation of RNA Pol II elongation complex
R-HSA-1234176, Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152, Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200, Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238, Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243, Tat-mediated HIV elongation arrest and recovery
R-HSA-167246, Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287, HIV elongation arrest and recovery
R-HSA-167290, Pausing and recovery of HIV elongation
R-HSA-180585, Vif-mediated degradation of APOBEC3G
R-HSA-674695, RNA Polymerase II Pre-transcription Events
R-HSA-6796648, TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955, RNA Polymerase II Transcription Elongation
R-HSA-8951664, Neddylation
R-HSA-9010553, Regulation of expression of SLITs and ROBOs
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6923, 745 hits in 1014 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TCEB2, human
EvolutionaryTraceiQ15370

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TCEB2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6923
PharosiQ15370, Tbio

Protein Ontology

More...PROi		PR:Q15370
RNActiQ15370, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000103363, Expressed in left testis and 251 other tissues
ExpressionAtlasiQ15370, baseline and differential
GenevisibleiQ15370, HS

Family and domain databases

InterProiView protein in InterPro
IPR039049, ELOB
IPR000626, Ubiquitin-like_dom
IPR029071, Ubiquitin-like_domsf
PANTHERiPTHR13248, PTHR13248, 1 hit
PfamiView protein in Pfam
PF00240, ubiquitin, 1 hit
SMARTiView protein in SMART
SM00213, UBQ, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50053, UBIQUITIN_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiELOB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15370
Secondary accession number(s): B7WPD3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2003
Last sequence update: November 1, 1996
Last modified: June 2, 2021
This is version 208 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again