ELOB

Functionⁱ

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).By similarity1 Publication

The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.4 Publications

Pathwayⁱ: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functionⁱ

ubiquitin protein ligase binding
Source: UniProtKB
Inferred from direct assayⁱ
- 17636018

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

post-translational protein modification Source: Reactome
protein-containing complex assembly
Source: ProtInc
Traceable author statementⁱ
- 7660129
protein ubiquitination Source: UniProtKB-UniPathway
regulation of transcription from RNA polymerase II promoter in response to hypoxia Source: Reactome
transcription by RNA polymerase II Source: Reactome
transcription elongation from RNA polymerase II promoter Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Transcription, Transcription regulation, Ubl conjugation pathway

Biological process

Transcription, Transcription regulation, Ubl conjugation pathway

Enzyme and pathway databases

Reactomeⁱ	R-HSA-112382 Formation of RNA Pol II elongation complex R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation R-HSA-167243 Tat-mediated HIV elongation arrest and recovery R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript R-HSA-167287 HIV elongation arrest and recovery R-HSA-167290 Pausing and recovery of HIV elongation R-HSA-180585 Vif-mediated degradation of APOBEC3G R-HSA-674695 RNA Polymerase II Pre-transcription Events R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes R-HSA-75955 RNA Polymerase II Transcription Elongation R-HSA-8951664 Neddylation R-HSA-9010553 Regulation of expression of SLITs and ROBOs R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayⁱ	UPA00143

Reactomeⁱ

R-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243 Tat-mediated HIV elongation arrest and recovery
R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287 HIV elongation arrest and recovery
R-HSA-167290 Pausing and recovery of HIV elongation
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955 RNA Polymerase II Transcription Elongation
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathwayⁱ

UPA00143

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Elongin-B Short name: EloB Alternative name(s): Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2
Gene namesⁱ	Name:ELOBImported Synonyms:TCEB2
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 16

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000103363.14
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11619 ELOB
MIMⁱ	600787 gene
neXtProtⁱ	NX_Q15370

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	6923
Open Targets More...OpenTargetsⁱ	ENSG00000103363
PharmGKBⁱ	PA36378

Chemistry databases

ChEMBLⁱ	CHEMBL3301400

ChEMBLⁱ

CHEMBL3301400

Polymorphism and mutation databases

BioMutaⁱ	TCEB2
DMDMⁱ	32699512

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000114914	1 – 118	Elongin-BAdd BLAST		118

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	1	N-acetylmethionineCombined sources1 Publication	1
Modified residueⁱ	84	PhosphothreonineBy similarity	1
Modified residueⁱ	108	PhosphoserineBy similarity	1
Modified residueⁱ	111	PhosphoserineBy similarity	1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	Q15370
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q15370
PaxDbⁱ	Q15370
PeptideAtlas More...PeptideAtlasⁱ	Q15370
PRIDEⁱ	Q15370
ProteomicsDBⁱ	60548
TopDownProteomicsⁱ	Q15370-1 [Q15370-1] Q15370-2 [Q15370-2]

PTM databases

iPTMnetⁱ	Q15370
PhosphoSitePlusⁱ	Q15370

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000103363 Expressed in 235 organ(s), highest expression level in left testis
CleanExⁱ	HS_TCEB2
ExpressionAtlasⁱ	Q15370 baseline and differential
Genevisibleⁱ	Q15370 HS

Interactionⁱ

Subunit structureⁱ

Heterotrimer of an A (ELOA, ELOA2 or ELOA3), ELOB and ELOC subunit (PubMed:10205047, PubMed:17997974). The elongin BC complex interacts with EPOP; leading to recruit the elongin BC complex to Polycomb group (PcG) target genes, thereby restricting excessive activity of the PRC2/EED-EZH2 complex (By similarity). Part of E3 ubiquitin ligase complexes with CUL5 or CUL2, RBX1 and a substrate adapter protein that can be either SOCS1, SOCS5, ELOA, VHL or WSB1 (PubMed:15590694, PubMed:22286099). Interacts with VHL (PubMed:10205047, PubMed:11006129). Found in a complex composed of LIMD1, VHL, EGLN1/PHD2, ELOB and CUL2. Interacts with SPSB1 (PubMed:17189197). Interacts with KLHDC10; which may be an E3 ubiquitin ligase complex substrate recognition component (PubMed:23102700).By similarity7 Publications

(Microbial infection) Substrate adapter protein can be a viral protein such as HIV Vif.1 Publication

(Microbial infection) Interacts with molluscum contagiosum virus MC132.1 Publication

(Microbial infection) Interacts with herpes virus 8 virus protein LANA1.1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
ELOC	Q15369	15	EBI-301238,EBI-301231
MED8	Q96G25	5	EBI-301238,EBI-394405
vif	P12504	5	EBI-301238,EBI-779991	From Human immunodeficiency virus type 1 group M subtype B (isolate NY5).

GO - Molecular functionⁱ

ubiquitin protein ligase binding
Source: UniProtKB
Inferred from direct assayⁱ
- 17636018

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	112785, 126 interactors
CORUMⁱ	Q15370
Database of interacting proteins More...DIPⁱ	DIP-29570N
IntActⁱ	Q15370, 59 interactors
Molecular INTeraction database More...MINTⁱ	Q15370
STRINGⁱ	9606.ENSP00000262306

Chemistry databases

BindingDBⁱ

Q15370

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	2 – 10	Combined sources	9
Beta strandⁱ	12 – 19	Combined sources	8
Helixⁱ	24 – 35	Combined sources	12
Helixⁱ	39 – 41	Combined sources	3
Beta strandⁱ	42 – 46	Combined sources	5
Beta strandⁱ	49 – 51	Combined sources	3
Turnⁱ	57 – 61	Combined sources	5
Helixⁱ	64 – 66	Combined sources	3
Beta strandⁱ	69 – 71	Combined sources	3
Beta strandⁱ	73 – 79	Combined sources	7
Beta strandⁱ	82 – 84	Combined sources	3
Helixⁱ	86 – 89	Combined sources	4
Turnⁱ	92 – 94	Combined sources	3
Beta strandⁱ	96 – 98	Combined sources	3
Helixⁱ	101 – 103	Combined sources	3
Beta strandⁱ	110 – 112	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	Q15370
SMRⁱ	Q15370
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

Q15370

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	1 – 66	Ubiquitin-likePROSITE-ProRule annotationAdd BLAST		66

Phylogenomic databases

eggNOGⁱ	KOG4495 Eukaryota ENOG4111UGJ LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000018316
HOGENOMⁱ	HOG000293425
HOVERGENⁱ	HBG008581
InParanoidⁱ	Q15370
KEGG Orthology (KO) More...KOⁱ	K03873
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G10A8
PhylomeDBⁱ	Q15370
TreeFamⁱ	TF325964

Family and domain databases

InterProⁱ	View protein in InterPro IPR039049 ELOB IPR029071 Ubiquitin-like_domsf IPR000626 Ubiquitin_dom
PANTHERⁱ	PTHR13248 PTHR13248, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00240 ubiquitin, 1 hit
SMARTⁱ	View protein in SMART SM00213 UBQ, 1 hit
SUPFAMⁱ	SSF54236 SSF54236, 1 hit
PROSITEⁱ	View protein in PROSITE PS50053 UBIQUITIN_2, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: Q15370-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVFLMIRRH KTTIFTDAKE SSTVFELKRI VEGILKRPPD EQRLYKDDQL 
        60         70         80         90        100
LDDGKTLGEC GFTSQTARPQ APATVGLAFR ADDTFEALCI EPFSSPPELP 
       110 
DVMKPQDSGS SANEQAVQ

Length:118

Mass (Da):13,133

Last modified:November 1, 1996 - v1

Checksum:ⁱC045F58FBED0EC47

GO

Isoform 2 (identifier: Q15370-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
118-118: Q → HLHVHSQTMAKSRNTSWSQCPGLTACSTREPQDGPTQVHPRWGL

« Hide

        10         20         30         40         50
MDVFLMIRRH KTTIFTDAKE SSTVFELKRI VEGILKRPPD EQRLYKDDQL 
        60         70         80         90        100
LDDGKTLGEC GFTSQTARPQ APATVGLAFR ADDTFEALCI EPFSSPPELP 
       110        120        130        140        150
DVMKPQDSGS SANEQAVHLH VHSQTMAKSR NTSWSQCPGL TACSTREPQD 
       160 
GPTQVHPRWG L

Note: No experimental confirmation available.

Show »

Length:161

Mass (Da):17,911

Checksum:ⁱ72277A4ACF21429F

GO

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

B8ZZU8	B8ZZU8_HUMAN	Elongin-B Elongin-B (Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), isoform CRA_b)	ELOB TCEB2, hCG_1778969	113	Annotation score:
I3L0M9	I3L0M9_HUMAN	Elongin-B Elongin-B	ELOB	140	Annotation score:
A0A0B4J296	A0A0B4J296_HUMAN	Elongin-B Elongin-B	ELOB	66	Annotation score:

Sequence cautionⁱ

The sequence AAC08452 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_045784	118	Q → HLHVHSQTMAKSRNTSWSQC PGLTACSTREPQDGPTQVHP RWGL in isoform 2. 1 Publication		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L42856 mRNA Translation: AAA75522.1 BM700019 mRNA No translation available. AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems. AC092117 Genomic DNA No translation available. CH471112 Genomic DNA Translation: EAW85472.1 CH471112 Genomic DNA Translation: EAW85474.1 BC013306 mRNA Translation: AAH13306.1 BC065000 mRNA Translation: AAH65000.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS32374.1 [Q15370-2] CCDS45387.1 [Q15370-1]
PIRⁱ	I59405
NCBI Reference Sequences More...RefSeqⁱ	NP_009039.1, NM_007108.3 [Q15370-1] NP_996896.1, NM_207013.2 [Q15370-2]
UniGeneⁱ	Hs.172772

Genome annotation databases

Ensemblⁱ	ENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2] ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]
GeneIDⁱ	6923
KEGGⁱ	hsa:6923
UCSC genome browser More...UCSCⁱ	uc002crm.4 human [Q15370-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q15370	ELOB isoform 1		PANTR		118	UniRef100_Q15370
Transcription elongation factor B polypeptide 2 isoform a		MACMU		118
ELOB isoform 1		PONAB		118
Uncharacterized protein		MACFA		118
Uncharacterized protein		RHIBE		118
+2

Protein	Similar proteins		Species	Score	Length	Source
Q15370	ELOB isoform 1		PANTR		118	UniRef90_Q15370
Transcription elongation factor B polypeptide 2 isoform a		MACMU		118
ELOB isoform 1		PONAB		118
Uncharacterized protein		MACFA		118
Uncharacterized protein		RHIBE		118
+5
Q15370-2	ELOB isoform 2		PANTR		161	UniRef90_Q15370-2
Elongin B		GORGO		161
Elongin B		PONAB		160
Uncharacterized protein		Cebus capucinus imitator		157
Uncharacterized protein		AOTNA		150
+2

Protein	Similar proteins		Species	Score	Length	Source
Q15370	Elongin-B	)	MOUSE		118	UniRef50_Q15370
Elongin-B		RAT		118
ELOB isoform 1		PANTR		118
Transcription elongation factor B polypeptide 2 isoform a		MACMU		118
ELOB isoform 1		PONAB		118
+164
Q15370-2	Elongin B		GORGO		161	UniRef50_Q15370-2
ELOB isoform 2		PANTR		161
Elongin B		PONAB		160
Uncharacterized protein		Cebus capucinus imitator		157
Uncharacterized protein		AOTNA		150
+20

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L42856 mRNA Translation: AAA75522.1 BM700019 mRNA No translation available. AC004493 Genomic DNA Translation: AAC08452.1 Sequence problems. AC092117 Genomic DNA No translation available. CH471112 Genomic DNA Translation: EAW85472.1 CH471112 Genomic DNA Translation: EAW85474.1 BC013306 mRNA Translation: AAH13306.1 BC065000 mRNA Translation: AAH65000.1
CCDSⁱ	CCDS32374.1 [Q15370-2] CCDS45387.1 [Q15370-1]
PIRⁱ	I59405
RefSeqⁱ	NP_009039.1, NM_007108.3 [Q15370-1] NP_996896.1, NM_207013.2 [Q15370-2]
UniGeneⁱ	Hs.172772

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1LM8	X-ray	1.85	B	1-118	[»]
	1LQB	X-ray	2.00	A	1-118	[»]
	1VCB	X-ray	2.70	A/D/G/J	1-118	[»]
	2C9W	X-ray	1.90	B	1-118	[»]
	2IZV	X-ray	2.55	B	1-118	[»]
	2JZ3	NMR	-	B	1-118	[»]
	2MA9	NMR	-	B	1-118	[»]
	3DCG	X-ray	2.40	A/C	1-118	[»]
	3ZKJ	X-ray	2.58	C/F	1-118	[»]
	3ZNG	X-ray	2.85	C/F	1-118	[»]
	3ZRC	X-ray	2.90	A/D/G/J	1-118	[»]
	3ZRF	X-ray	2.80	A/D/G/J	1-118	[»]
	3ZTC	X-ray	2.65	A/D/G/J	1-118	[»]
	3ZTD	X-ray	2.79	A/D/G/J	1-118	[»]
	3ZUN	X-ray	2.50	A/D/G/J	1-118	[»]
	4AJY	X-ray	1.73	B	1-118	[»]
	4AWJ	X-ray	2.50	A/D/G/J	1-104	[»]
	4B95	X-ray	2.80	A/D/G/J	1-118	[»]
	4B9K	X-ray	2.00	A/D/G/J	1-104	[»]
	4BKS	X-ray	2.20	A/D/G/J	1-104	[»]
	4BKT	X-ray	2.35	A/D/G/J	1-104	[»]
	4N9F	X-ray	3.30	4/D/H/J/P/W/X/e/g/m/s/y	1-102	[»]
	4W9C	X-ray	2.20	A/D/G/J	1-104	[»]
	4W9D	X-ray	2.20	A/D/G/J	1-104	[»]
	4W9E	X-ray	2.60	A/D/G/J	1-104	[»]
	4W9F	X-ray	2.10	A/D/G/J	1-104	[»]
	4W9G	X-ray	2.70	A/D/G/J	1-104	[»]
	4W9H	X-ray	2.10	A/D/G/J	1-104	[»]
	4W9I	X-ray	2.40	A/D/G/J	1-104	[»]
	4W9J	X-ray	2.20	A/D/G/J	1-104	[»]
	4W9K	X-ray	2.10	A/D/G/J	1-104	[»]
	4W9L	X-ray	2.20	A/D/G/J	1-104	[»]
	4WQO	X-ray	3.20	B	1-118	[»]
	5BO4	X-ray	2.90	B/E/H/K/N/Q	1-104	[»]
	5LLI	X-ray	2.40	A/D/G/J	1-104	[»]
	5N4W	X-ray	3.90	B	1-104	[»]
	5NVV	X-ray	2.10	A/D/G/J	1-104	[»]
	5NVW	X-ray	2.20	A/D/G/J	1-104	[»]
	5NVX	X-ray	2.20	A/D/G/J	1-104	[»]
	5NVY	X-ray	2.90	A/D/G/J	1-104	[»]
	5NVZ	X-ray	2.70	A/D/G/J	1-104	[»]
	5NW0	X-ray	2.30	A/D/G/J	1-104	[»]
	5NW1	X-ray	2.10	A/D/G/J	1-104	[»]
	5NW2	X-ray	2.20	A/D/G/J	1-104	[»]
	5T35	X-ray	2.70	B/F	1-104	[»]
	6BVB	X-ray	2.00	B	1-118	[»]
	6C5X	X-ray	3.10	B/E	1-118	[»]
	6FMI	X-ray	2.80	A/D	1-104	[»]
	6FMJ	X-ray	2.45	A/D/G/J	1-104	[»]
	6FMK	X-ray	2.75	A/D/G/J	1-104	[»]
	6GFX	X-ray	1.83	A	1-104	[»]
	6GFY	X-ray	2.70	A/D/G/J	1-104	[»]
	6GFZ	X-ray	2.30	A/D/G/J	1-104	[»]
	6GMN	X-ray	1.94	A/D/G/J	1-104	[»]
	6GMQ	X-ray	2.75	A/D/G/J	1-104	[»]
	6GMR	X-ray	1.75	B	1-118	[»]
	6GMX	X-ray	2.53	A/D/G/J	1-104	[»]
ProteinModelPortalⁱ	Q15370
SMRⁱ	Q15370
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112785, 126 interactors
CORUMⁱ	Q15370
DIPⁱ	DIP-29570N
IntActⁱ	Q15370, 59 interactors
MINTⁱ	Q15370
STRINGⁱ	9606.ENSP00000262306

Chemistry databases

BindingDBⁱ	Q15370
ChEMBLⁱ	CHEMBL3301400

PTM databases

iPTMnetⁱ	Q15370
PhosphoSitePlusⁱ	Q15370

Polymorphism and mutation databases

BioMutaⁱ	TCEB2
DMDMⁱ	32699512

Proteomic databases

EPDⁱ	Q15370
MaxQBⁱ	Q15370
PaxDbⁱ	Q15370
PeptideAtlasⁱ	Q15370
PRIDEⁱ	Q15370
ProteomicsDBⁱ	60548
TopDownProteomicsⁱ	Q15370-1 [Q15370-1] Q15370-2 [Q15370-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	6923
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000262306; ENSP00000262306; ENSG00000103363 [Q15370-2] ENST00000409906; ENSP00000386652; ENSG00000103363 [Q15370-1]
GeneIDⁱ	6923
KEGGⁱ	hsa:6923
UCSCⁱ	uc002crm.4 human [Q15370-1]

Organism-specific databases

CTDⁱ	6923
DisGeNETⁱ	6923
EuPathDBⁱ	HostDB:ENSG00000103363.14
GeneCardsⁱ	ELOB
HGNCⁱ	HGNC:11619 ELOB
MIMⁱ	600787 gene
neXtProtⁱ	NX_Q15370
OpenTargetsⁱ	ENSG00000103363
PharmGKBⁱ	PA36378
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4495 Eukaryota ENOG4111UGJ LUCA
GeneTreeⁱ	ENSGT00390000018316
HOGENOMⁱ	HOG000293425
HOVERGENⁱ	HBG008581
InParanoidⁱ	Q15370
KOⁱ	K03873
OrthoDBⁱ	EOG091G10A8
PhylomeDBⁱ	Q15370
TreeFamⁱ	TF325964

Enzyme and pathway databases

UniPathwayⁱ	UPA00143
Reactomeⁱ	R-HSA-112382 Formation of RNA Pol II elongation complex R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation R-HSA-167243 Tat-mediated HIV elongation arrest and recovery R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript R-HSA-167287 HIV elongation arrest and recovery R-HSA-167290 Pausing and recovery of HIV elongation R-HSA-180585 Vif-mediated degradation of APOBEC3G R-HSA-674695 RNA Polymerase II Pre-transcription Events R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes R-HSA-75955 RNA Polymerase II Transcription Elongation R-HSA-8951664 Neddylation R-HSA-9010553 Regulation of expression of SLITs and ROBOs R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathwayⁱ

UPA00143

Reactomeⁱ

R-HSA-112382 Formation of RNA Pol II elongation complex
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-167152 Formation of HIV elongation complex in the absence of HIV Tat
R-HSA-167200 Formation of HIV-1 elongation complex containing HIV-1 Tat
R-HSA-167238 Pausing and recovery of Tat-mediated HIV elongation
R-HSA-167243 Tat-mediated HIV elongation arrest and recovery
R-HSA-167246 Tat-mediated elongation of the HIV-1 transcript
R-HSA-167287 HIV elongation arrest and recovery
R-HSA-167290 Pausing and recovery of HIV elongation
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-674695 RNA Polymerase II Pre-transcription Events
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes
R-HSA-75955 RNA Polymerase II Transcription Elongation
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

EvolutionaryTraceⁱ	Q15370
GeneWikiⁱ	TCEB2
GenomeRNAiⁱ	6923
Protein Ontology More...PROⁱ	PR:Q15370
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000103363 Expressed in 235 organ(s), highest expression level in left testis
CleanExⁱ	HS_TCEB2
ExpressionAtlasⁱ	Q15370 baseline and differential
Genevisibleⁱ	Q15370 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR039049 ELOB IPR029071 Ubiquitin-like_domsf IPR000626 Ubiquitin_dom
PANTHERⁱ	PTHR13248 PTHR13248, 1 hit
Pfamⁱ	View protein in Pfam PF00240 ubiquitin, 1 hit
SMARTⁱ	View protein in SMART SM00213 UBQ, 1 hit
SUPFAMⁱ	SSF54236 SSF54236, 1 hit
PROSITEⁱ	View protein in PROSITE PS50053 UBIQUITIN_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ELOB_HUMAN
Accessionⁱ	Q15370Primary (citable) accession number: Q15370 Secondary accession number(s): B7WPD3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 11, 2003
	Last sequence update:	November 1, 1996
	Last modified:	November 7, 2018
	This is version 190 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q15370 (ELOB_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Elongin-B

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Cytosol

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Pathwayⁱ: protein ubiquitination

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ