UniProtKB - Q15365 (PCBP1_HUMAN)

BLAST

>sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS

Align
Format
Add to basket Added to basket
History
Entry version 189 (07 Nov 2018)
Sequence version 2 (16 Feb 2004)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Poly(rC)-binding protein 1

Gene

PCBP1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. In case of infection by poliovirus, plays a role in initiation of viral RNA replication in concert with the viral protein 3CD (PubMed:12414943).1 Publication

GO - Molecular functionⁱ

cadherin binding
Source: BHF-UCL
Inferred from high throughput direct assayⁱ
- 25468996
DNA-binding transcription factor activity, RNA polymerase II-specific Source: Ensembl
mRNA binding
Source: BHF-UCL
Inferred from direct assayⁱ
- 14722620
RNA binding
Source: UniProtKB
Inferred from direct assayⁱ
sequence-specific single stranded DNA binding Source: Ensembl
single-stranded DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 8152927

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

mRNA splicing, via spliceosome Source: Reactome
positive regulation of transcription by RNA polymerase II Source: Ensembl
RNA metabolic process Source: Reactome
viral RNA genome replication
Source: UniProtKB
Inferred from direct assayⁱ
- 12414943

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding, Ribonucleoprotein, RNA-binding
Biological process	Viral RNA replication

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway R-HSA-72203 Processing of Capped Intron-Containing Pre-mRNA

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72203 Processing of Capped Intron-Containing Pre-mRNA

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Poly(rC)-binding protein 1 Alternative name(s): Alpha-CP1 Heterogeneous nuclear ribonucleoprotein E1 Short name: hnRNP E1 Nucleic acid-binding protein SUB2.3
Gene namesⁱ	Name:PCBP1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000169564.6
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:8647 PCBP1
MIMⁱ	601209 gene
neXtProtⁱ	NX_Q15365

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	5093
Open Targets More...OpenTargetsⁱ	ENSG00000169564
PharmGKBⁱ	PA32986

Polymorphism and mutation databases

BioMutaⁱ	PCBP1
DMDMⁱ	42560548

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000050087	1 – 356	Poly(rC)-binding protein 1Add BLAST		356

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	1	N-acetylmethionineCombined sources	1
Cross-linkⁱ	115	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residueⁱ	173	PhosphoserineCombined sources	1
Modified residueⁱ	189	PhosphoserineBy similarity	1
Modified residueⁱ	190	PhosphoserineCombined sources	1
Modified residueⁱ	246	PhosphoserineCombined sources	1
Modified residueⁱ	264	PhosphoserineCombined sources	1
Modified residueⁱ	273	PhosphoserineCombined sources	1

Post-translational modificationⁱ

Phosphorylated; lowers poly(rC)-binding activity.

Keywords - PTMⁱ

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	Q15365
PaxDbⁱ	Q15365
PeptideAtlas More...PeptideAtlasⁱ	Q15365
PRIDEⁱ	Q15365
ProteomicsDBⁱ	60541
TopDownProteomicsⁱ	Q15365

2D gel databases

USC-OGP 2-DE database More...OGPⁱ	Q15365
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEⁱ	IPI00016610
UCD-2DPAGEⁱ	Q15365

PTM databases

iPTMnetⁱ	Q15365
PhosphoSitePlusⁱ	Q15365
SwissPalmⁱ	Q15365

Expressionⁱ

Tissue specificityⁱ

Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands.

Gene expression databases

Bgeeⁱ	ENSG00000169564 Expressed in 239 organ(s), highest expression level in vastus lateralis
CleanExⁱ	HS_PCBP1
ExpressionAtlasⁱ	Q15365 baseline and differential
Genevisibleⁱ	Q15365 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB037113 HPA043803 HPA068497

HPAⁱ

CAB037113
HPA043803
HPA068497

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
GAMMAHV.ORF34	O41951	4	EBI-946095,EBI-9640556	From Murid herpesvirus 4.
PA	Q67020	2	EBI-946095,EBI-11514477	From Influenza A virus (A/WSN/1933(H1N1)).
PAK1	Q13153	2	EBI-946095,EBI-1307
PAK1	Q13153-1	5	EBI-946095,EBI-15628682
PCBP2	Q15366	2	EBI-946095,EBI-945799
PPIG	Q13427	2	EBI-946095,EBI-396072
PRPF8	Q6P2Q9	2	EBI-946095,EBI-538479
PTBP1	P26599	2	EBI-946095,EBI-350540
PUF60	Q9UHX1	2	EBI-946095,EBI-1053259
QKI	Q96PU8	2	EBI-946095,EBI-945792
RBM39	Q14498	2	EBI-946095,EBI-395290
RBM39	Q14498-2	2	EBI-946095,EBI-11032687
SNRPA	P09012	5	EBI-946095,EBI-607085
THAP11	Q96EK4	4	EBI-946095,EBI-1790529
TSC22D4	Q9Y3Q8	2	EBI-946095,EBI-739485
WBP11	Q9Y2W2	2	EBI-946095,EBI-714455
ZNF830	Q96NB3	2	EBI-946095,EBI-3920997

GO - Molecular functionⁱ

cadherin binding
Source: BHF-UCL
Inferred from high throughput direct assayⁱ
- 25468996

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	111126, 185 interactors
Database of interacting proteins More...DIPⁱ	DIP-38136N
IntActⁱ	Q15365, 105 interactors
Molecular INTeraction database More...MINTⁱ	Q15365
STRINGⁱ	9606.ENSP00000305556

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	14 – 21	Combined sources	8
Helixⁱ	22 – 29	Combined sources	8
Helixⁱ	31 – 33	Combined sources	3
Helixⁱ	34 – 43	Combined sources	10
Beta strandⁱ	46 – 49	Combined sources	4
Beta strandⁱ	55 – 64	Combined sources	10
Helixⁱ	65 – 81	Combined sources	17
Turnⁱ	82 – 84	Combined sources	3
Beta strandⁱ	280 – 287	Combined sources	8
Helixⁱ	288 – 290	Combined sources	3
Helixⁱ	291 – 295	Combined sources	5
Helixⁱ	297 – 299	Combined sources	3
Helixⁱ	300 – 309	Combined sources	10
Beta strandⁱ	312 – 315	Combined sources	4
Beta strandⁱ	323 – 331	Combined sources	9
Helixⁱ	333 – 346	Combined sources	14

Show more details

3D structure databases

ProteinModelPortalⁱ	Q15365
SMRⁱ	Q15365
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q15365

EvolutionaryTraceⁱ

Q15365

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Domainⁱ	13 – 75	KH 1PROSITE-ProRule annotationAdd BLAST	63
Domainⁱ	97 – 162	KH 2PROSITE-ProRule annotationAdd BLAST	66
Domainⁱ	279 – 343	KH 3PROSITE-ProRule annotationAdd BLAST	65

Keywords - Domainⁱ

Repeat

Phylogenomic databases

eggNOGⁱ	KOG2190 Eukaryota ENOG410XNN8 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000119144
HOGENOMⁱ	HOG000182823
HOVERGENⁱ	HBG053520
InParanoidⁱ	Q15365
KEGG Orthology (KO) More...KOⁱ	K12889
OMAⁱ	TLTKLHQ
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0DHI
PhylomeDBⁱ	Q15365
TreeFamⁱ	TF318292

Family and domain databases

Gene3Dⁱ	3.30.1370.10, 3 hits
InterProⁱ	View protein in InterPro IPR004087 KH_dom IPR004088 KH_dom_type_1 IPR036612 KH_dom_type_1_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00013 KH_1, 3 hits
SMARTⁱ	View protein in SMART SM00322 KH, 3 hits
SUPFAMⁱ	SSF54791 SSF54791, 3 hits
PROSITEⁱ	View protein in PROSITE PS50084 KH_TYPE_1, 3 hits

Sequenceⁱ

Sequence statusⁱ: Complete.

Q15365-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MDAGVTESGL NVTLTIRLLM HGKEVGSIIG KKGESVKRIR EESGARINIS 
        60         70         80         90        100
EGNCPERIIT LTGPTNAIFK AFAMIIDKLE EDINSSMTNS TAASRPPVTL 
       110        120        130        140        150
RLVVPATQCG SLIGKGGCKI KEIRESTGAQ VQVAGDMLPN STERAITIAG 
       160        170        180        190        200
VPQSVTECVK QICLVMLETL SQSPQGRVMT IPYQPMPASS PVICAGGQDR 
       210        220        230        240        250
CSDAAGYPHA THDLEGPPLD AYSIQGQHTI SPLDLAKLNQ VARQQSHFAM 
       260        270        280        290        300
MHGGTGFAGI DSSSPEVKGY WASLDASTQT THELTIPNNL IGCIIGRQGA 
       310        320        330        340        350
NINEIRQMSG AQIKIANPVE GSSGRQVTIT GSAASISLAQ YLINARLSSE 

KGMGCS

Length:356

Mass (Da):37,498

Last modified:February 16, 2004 - v2

Checksum:ⁱ6D1A261276CA206D

Sequence cautionⁱ

The sequence CAA82631 differs from that shown. Reason: Frameshift at position 301.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	205	A → V in CAA55016 (PubMed:7607214).Curated		1
Sequence conflictⁱ	299 – 300	Missing in CAA82631 (PubMed:8152927).Curated		2

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X78137 mRNA Translation: CAA55016.1 U24223 mRNA Translation: AAA91317.1 Z29505 mRNA Translation: CAA82631.1 Frameshift. BC039742 mRNA Translation: AAH39742.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1898.1
NCBI Reference Sequences More...RefSeqⁱ	NP_006187.2, NM_006196.3
UniGeneⁱ	Hs.2853

Genome annotation databases

Ensemblⁱ	ENST00000303577; ENSP00000305556; ENSG00000169564
GeneIDⁱ	5093
KEGGⁱ	hsa:5093

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q15365	Poly(rC)-binding protein 1		BOVIN		356	UniRef100_Q15365
Poly(rC)-binding protein 1		MOUSE		356
Poly(rC)-binding protein 1		RABIT		356
Putative polyc-binding alphacp-1 (Fragment)		DESRO		365
Epididymis secretory protein Li 85		HUMAN		356
+43

Protein	Similar proteins		Species	Score	Length	Source
Q15365	Poly(rC)-binding protein 1		BOVIN		356	UniRef90_Q15365
Poly(rC)-binding protein 1		MOUSE		356
Poly(rC)-binding protein 1		RABIT		356
Putative polyc-binding alphacp-1 (Fragment)		DESRO		365
Epididymis secretory protein Li 85		HUMAN		356
+100

Protein	Similar proteins		Species	Score	Length	Source
Q15365	Poly(rC)-binding protein 2	)	HUMAN		365	UniRef50_Q15366
Poly(rC)-binding protein 2		MOUSE		362
Poly(rC)-binding protein 1		BOVIN		356
Poly(rC)-binding protein 1		RABIT		356
poly(RC)-binding protein 2 isoform X2		DELLE		365
+580

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X78137 mRNA Translation: CAA55016.1 U24223 mRNA Translation: AAA91317.1 Z29505 mRNA Translation: CAA82631.1 Frameshift. BC039742 mRNA Translation: AAH39742.1
CCDSⁱ	CCDS1898.1
RefSeqⁱ	NP_006187.2, NM_006196.3
UniGeneⁱ	Hs.2853

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1WVN	X-ray	2.10	A	279-356	[»]
	1ZTG	X-ray	3.00	A/B/C/D	14-85	[»]
	3VKE	X-ray	1.77	A/B/C/D	14-86	[»]
ProteinModelPortalⁱ	Q15365
SMRⁱ	Q15365
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	111126, 185 interactors
DIPⁱ	DIP-38136N
IntActⁱ	Q15365, 105 interactors
MINTⁱ	Q15365
STRINGⁱ	9606.ENSP00000305556

PTM databases

iPTMnetⁱ	Q15365
PhosphoSitePlusⁱ	Q15365
SwissPalmⁱ	Q15365

Polymorphism and mutation databases

BioMutaⁱ	PCBP1
DMDMⁱ	42560548

2D gel databases

OGPⁱ	Q15365
REPRODUCTION-2DPAGEⁱ	IPI00016610
UCD-2DPAGEⁱ	Q15365

Proteomic databases

EPDⁱ	Q15365
PaxDbⁱ	Q15365
PeptideAtlasⁱ	Q15365
PRIDEⁱ	Q15365
ProteomicsDBⁱ	60541
TopDownProteomicsⁱ	Q15365

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	5093
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000303577; ENSP00000305556; ENSG00000169564
GeneIDⁱ	5093
KEGGⁱ	hsa:5093

Organism-specific databases

CTDⁱ	5093
DisGeNETⁱ	5093
EuPathDBⁱ	HostDB:ENSG00000169564.6
GeneCardsⁱ	PCBP1
HGNCⁱ	HGNC:8647 PCBP1
HPAⁱ	CAB037113 HPA043803 HPA068497
MIMⁱ	601209 gene
neXtProtⁱ	NX_Q15365
OpenTargetsⁱ	ENSG00000169564
PharmGKBⁱ	PA32986
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2190 Eukaryota ENOG410XNN8 LUCA
GeneTreeⁱ	ENSGT00760000119144
HOGENOMⁱ	HOG000182823
HOVERGENⁱ	HBG053520
InParanoidⁱ	Q15365
KOⁱ	K12889
OMAⁱ	TLTKLHQ
OrthoDBⁱ	EOG091G0DHI
PhylomeDBⁱ	Q15365
TreeFamⁱ	TF318292

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway R-HSA-72203 Processing of Capped Intron-Containing Pre-mRNA

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72203 Processing of Capped Intron-Containing Pre-mRNA

Miscellaneous databases

ChiTaRSⁱ	PCBP1 human
EvolutionaryTraceⁱ	Q15365
GeneWikiⁱ	PCBP1
GenomeRNAiⁱ	5093
Protein Ontology More...PROⁱ	PR:Q15365
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000169564 Expressed in 239 organ(s), highest expression level in vastus lateralis
CleanExⁱ	HS_PCBP1
ExpressionAtlasⁱ	Q15365 baseline and differential
Genevisibleⁱ	Q15365 HS

Family and domain databases

Gene3Dⁱ	3.30.1370.10, 3 hits
InterProⁱ	View protein in InterPro IPR004087 KH_dom IPR004088 KH_dom_type_1 IPR036612 KH_dom_type_1_sf
Pfamⁱ	View protein in Pfam PF00013 KH_1, 3 hits
SMARTⁱ	View protein in SMART SM00322 KH, 3 hits
SUPFAMⁱ	SSF54791 SSF54791, 3 hits
PROSITEⁱ	View protein in PROSITE PS50084 KH_TYPE_1, 3 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PCBP1_HUMAN
Accessionⁱ	Q15365Primary (citable) accession number: Q15365 Secondary accession number(s): Q13157, Q14975
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2000
	Last sequence update:	February 16, 2004
	Last modified:	November 7, 2018
	This is version 189 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q15365 (PCBP1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Poly(rC)-binding protein 1

PCBP1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Cytosol

Extracellular region or secreted

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ