Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pericentriolar material 1 protein

Gene

PCM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for centrosome assembly and function (PubMed:12403812, PubMed:15659651, PubMed:16943179). Essential for the correct localization of several centrosomal proteins including CEP250, CETN3, PCNT and NEK2 (PubMed:12403812, PubMed:15659651). Required to anchor microtubules to the centrosome (PubMed:12403812, PubMed:15659651). Involved in the biogenesis of cilia (PubMed:20551181, PubMed:24121310).5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-8854518 AURKA Activation by TPX2

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q15154

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q15154 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pericentriolar material 1 protein
Short name:
PCM-1
Short name:
hPCM-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCM1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000078674.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8727 PCM1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600299 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15154

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving PCM1 is found in papillary thyroid carcinomas (PTCs) (PubMed:10980597). Translocation t(8;10)(p21.3;q11.2) with RET links the protein kinase domain of RET to the major portion of PCM1 (PubMed:10980597).1 Publication
A chromosomal aberration involving PCM1 is found in a variety of hematological malignancies including atypical chronic myeloid leukemia (atypical CML) and T-cell lymphoma (PubMed:15805263, PubMed:16034466, PubMed:16091753, PubMed:16769584, PubMed:16424865). Translocation t(8;9)(p22;p24) with JAK2 links the protein kinase domain of JAK2 to the major portion of PCM1 (PubMed:15805263, PubMed:16034466, PubMed:16091753, PubMed:16769584, PubMed:16424865).5 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei1314 – 1315Breakpoint for translocation to form PCM1-JAK2 fusion protein2
Sitei1369 – 1370Breakpoint for translocation to form PCM1-JAK2 fusion protein2
Sitei1470 – 1471Breakpoint for translocation to form PCM1-JAK2 fusion protein2
Sitei1609 – 1610Breakpoint for translocation to form PCM1-RET fusion protein2
Sitei1947 – 1948Breakpoint for translocation to form PCM1-JAK2 fusion protein2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
5108

MalaCards human disease database

More...
MalaCardsi
PCM1

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
146 Differentiated thyroid carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33073

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PCM1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439495

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002740372 – 2024Pericentriolar material 1 proteinAdd BLAST2023

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei65PhosphoserineCombined sources1
Modified residuei68PhosphoserineCombined sources1
Modified residuei69PhosphoserineCombined sources1
Modified residuei93PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei116PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei159Phosphoserine; in variant Ser-159Combined sources1
Modified residuei370PhosphoserineCombined sources1
Modified residuei372PhosphoserineCombined sources1
Modified residuei384PhosphoserineCombined sources1
Modified residuei399N6-acetyllysineCombined sources1
Modified residuei588PhosphoserineCombined sources1
Modified residuei643PhosphoserineBy similarity1
Modified residuei859PhosphothreonineCombined sources1
Modified residuei861PhosphoserineCombined sources1
Modified residuei866PhosphoserineBy similarity1
Modified residuei869PhosphoserineBy similarity1
Modified residuei872PhosphoserineBy similarity1
Modified residuei877PhosphothreonineBy similarity1
Modified residuei960PhosphoserineCombined sources1
Modified residuei977PhosphoserineCombined sources1
Modified residuei988PhosphoserineCombined sources1
Modified residuei991PhosphoserineCombined sources1
Modified residuei1185PhosphoserineCombined sources1
Modified residuei1188PhosphoserineBy similarity1
Modified residuei1229PhosphoserineCombined sources1
Modified residuei1231PhosphoserineCombined sources1
Modified residuei1257PhosphoserineCombined sources1
Modified residuei1260PhosphoserineCombined sources1
Modified residuei1262PhosphoserineBy similarity1
Modified residuei1263PhosphoserineCombined sources1
Modified residuei1318PhosphoserineBy similarity1
Modified residuei1320PhosphoserineBy similarity1
Modified residuei1468PhosphothreonineCombined sources1
Modified residuei1573PhosphoserineBy similarity1
Modified residuei1697PhosphoserineCombined sources1
Modified residuei1730PhosphoserineCombined sources1
Modified residuei1765PhosphoserineCombined sources1
Modified residuei1768PhosphoserineCombined sources1
Modified residuei1776PhosphoserineCombined sources1
Modified residuei1782PhosphoserineBy similarity1
Modified residuei1958PhosphoserineCombined sources1
Modified residuei1977PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated. Undergoes monoubiquitination catalyzed by the E3 ubiquitin-protein ligase MIB1 in proliferating cells, preventing cilia formation (PubMed:24121310). Monoubiquitination by MIB1 is inhibited in response to cellular stress, such as ultraviolet light (UV) radiation or heat shock, resulting in cilia formation initiation (PubMed:24121310).1 Publication
Variant Ser-159 is phosphorylated.Combined sources
Phosphorylated on multiple serine and threonine residues by DYRK3 during the G2-to-M transition, after the nuclear-envelope breakdown (PubMed:29973724). Phosphorylation by DYRK3 promotes disassembly of pericentriolar material (PubMed:29973724).1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15154

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15154

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15154

PeptideAtlas

More...
PeptideAtlasi
Q15154

PRoteomics IDEntifications database

More...
PRIDEi
Q15154

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60471
60472 [Q15154-2]
60473 [Q15154-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q15154

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15154

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15154

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in blood, bone marrow, breast, lymph node, ovary and thyroid.4 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression is reduced in breast and ovarian cancer.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000078674 Expressed in 232 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_PCM1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15154 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15154 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB058695
HPA023370
HPA023374

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Self-associates. Interacts with C2CD3 (By similarity). Interacts with BBS4, BBS8, CETN3, HAP1, NDE1, NDEL1, MAP1LC3B, GABARAPAL2, and GABARAP (PubMed:12403812, PubMed:14520415, PubMed:15107855, PubMed:16291865, PubMed:24089205, PubMed:9361024). Interacts with CEP131; the interaction increases in response to ultraviolet light (UV) radiation (PubMed:24121310). Associates with microtubule; association to microtubule is reduced in response to cellular stress, such as ultraviolet light (UV) radiation or heat shock, in a process that requires p38 MAP kinase signaling (PubMed:24121310). Interacts with CCDC113 (PubMed:25074808). Interacts with SSX2IP (By similarity). Interacts with CCDC13 (PubMed:24816561). Interacts with CEP290 (By similarity). Interacts with PARD6A (PubMed:20719959). Interacts with KIAA0753/OFIP, FOPNL/FOR20 and OFD1; the interaction with FOPNL/FOR20 and OFD1 may be mediated by KIAA0753/OFIP (PubMed:26643951). Interacts with CCDC66 (PubMed:28235840).By similarity12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111139, 293 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q15154

Database of interacting proteins

More...
DIPi
DIP-42189N

Protein interaction database and analysis system

More...
IntActi
Q15154, 282 interactors

Molecular INTeraction database

More...
MINTi
Q15154

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000327077

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15154

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15154

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1279 – 1799Interaction with HAP11 PublicationAdd BLAST521
Regioni1913 – 2024Interaction with BBS41 PublicationAdd BLAST112

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili218 – 301Sequence analysisAdd BLAST84
Coiled coili400 – 424Sequence analysisAdd BLAST25
Coiled coili487 – 543Sequence analysisAdd BLAST57
Coiled coili651 – 682Sequence analysisAdd BLAST32
Coiled coili726 – 769Sequence analysisAdd BLAST44
Coiled coili824 – 858Sequence analysisAdd BLAST35
Coiled coili1063 – 1089Sequence analysisAdd BLAST27
Coiled coili1515 – 1539Sequence analysisAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PCM1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEGR Eukaryota
ENOG410YNFX LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000115473

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053890

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15154

KEGG Orthology (KO)

More...
KOi
K16537

Database of Orthologous Groups

More...
OrthoDBi
500021at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15154

TreeFam database of animal gene trees

More...
TreeFami
TF328740

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031446 PCM1_C
IPR024138 Pericentriolar_Pcm1

The PANTHER Classification System

More...
PANTHERi
PTHR14164 PTHR14164, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15717 PCM1_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15154-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGGGPFED GMNDQDLPNW SNENVDDRLN NMDWGAQQKK ANRSSEKNKK
60 70 80 90 100
KFGVESDKRV TNDISPESSP GVGRRRTKTP HTFPHSRYMS QMSVPEQAEL
110 120 130 140 150
EKLKQRINFS DLDQRSIGSD SQGRATAANN KRQLSENRKP FNFLPMQINT
160 170 180 190 200
NKSKDASTNP PNRETIGSAQ CKELFASALS NDLLQNCQVS EEDGRGEPAM
210 220 230 240 250
ESSQIVSRLV QIRDYITKAS SMREDLVEKN ERSANVERLT HLIDHLKEQE
260 270 280 290 300
KSYMKFLKKI LARDPQQEPM EEIENLKKQH DLLKRMLQQQ EQLRALQGRQ
310 320 330 340 350
AALLALQHKA EQAIAVMDDS VVAETAGSLS GVSITSELNE ELNDLIQRFH
360 370 380 390 400
NQLRDSQPPA VPDNRRQAES LSLTREVSQS RKPSASERLP DEKVELFSKM
410 420 430 440 450
RVLQEKKQKM DKLLGELHTL RDQHLNNSSA SPQRSVDQRS TSAPSASVGL
460 470 480 490 500
APVVNGESNS LTSSVPYPTA SLVSQNESEN EGHLNPSEKL QKLNEVRKRL
510 520 530 540 550
NELRELVHYY EQTSDMMTDA VNENRKDEET EESEYDSEHE NSEPVTNIRN
560 570 580 590 600
PQVASTWNEV NSHSNAQCVS NNRDGRTVNS NCEINNRSAA NIRALNMPPS
610 620 630 640 650
LDCRYNREGE QEIHVAQGED DEEEEEEAEE EGVSGASLSS HRSSLVDEHP
660 670 680 690 700
EDAEFEQKIN RLMAAKQKLR QLQDLVAMVQ DDDAAQGVIS ASASNLDDFY
710 720 730 740 750
PAEEDTKQNS NNTRGNANKT QKDTGVNEKA REKFYEAKLQ QQQRELKQLQ
760 770 780 790 800
EERKKLIDIQ EKIQALQTAC PDLQLSAASV GNCPTKKYMP AVTSTPTVNQ
810 820 830 840 850
HETSTSKSVF EPEDSSIVDN ELWSEMRRHE MLREELRQRR KQLEALMAEH
860 870 880 890 900
QRRQGLAETA SPVAVSLRSD GSENLCTPQQ SRTEKTMATW GGSTQCALDE
910 920 930 940 950
EGDEDGYLSE GIVRTDEEEE EEQDASSNDN FSVCPSNSVN HNSYNGKETK
960 970 980 990 1000
NRWKNNCPFS ADENYRPLAK TRQQNISMQR QENLRWVSEL SYVEEKEQWQ
1010 1020 1030 1040 1050
EQINQLKKQL DFSVSICQTL MQDQQTLSCL LQTLLTGPYS VMPSNVASPQ
1060 1070 1080 1090 1100
VHFIMHQLNQ CYTQLTWQQN NVQRLKQMLN ELMRQQNQHP EKPGGKERGS
1110 1120 1130 1140 1150
SASHPPSPSL FCPFSFPTQP VNLFNIPGFT NFSSFAPGMN FSPLFPSNFG
1160 1170 1180 1190 1200
DFSQNISTPS EQQQPLAQNS SGKTEYMAFP KPFESSSSIG AEKPRNKKLP
1210 1220 1230 1240 1250
EEEVESSRTP WLYEQEGEVE KPFIKTGFSV SVEKSTSSNR KNQLDTNGRR
1260 1270 1280 1290 1300
RQFDEESLES FSSMPDPVDP TTVTKTFKTR KASAQASLAS KDKTPKSKSK
1310 1320 1330 1340 1350
KRNSTQLKSR VKNIRYESAS MSSTCEPCKS RNRHSAQTEE PVQAKVFSRK
1360 1370 1380 1390 1400
NHEQLEKIIK CNRSTEISSE TGSDFSMFEA LRDTIYSEVA TLISQNESRP
1410 1420 1430 1440 1450
HFLIELFHEL QLLNTDYLRQ RALYALQDIV SRHISESHEK GENVKSVNSG
1460 1470 1480 1490 1500
TWIASNSELT PSESLATTDD ETFEKNFERE THKISEQNDA DNASVLSVSS
1510 1520 1530 1540 1550
NFEPFATDDL GNTVIHLDQA LARMREYERM KTEAESNSNM RCTCRIIEDG
1560 1570 1580 1590 1600
DGAGAGTTVN NLEETPVIEN RSSQQPVSEV STIPCPRIDT QQLDRQIKAI
1610 1620 1630 1640 1650
MKEVIPFLKE HMDEVCSSQL LTSVRRMVLT LTQQNDESKE FVKFFHKQLG
1660 1670 1680 1690 1700
SILQDSLAKF AGRKLKDCGE DLLVEISEVL FNELAFFKLM QDLDNNSITV
1710 1720 1730 1740 1750
KQRCKRKIEA TGVIQSCAKE AKRILEDHGS PAGEIDDEDK DKDETETVKQ
1760 1770 1780 1790 1800
TQTSEVYDGP KNVRSDISDQ EEDEESEGCP VSINLSKAET QALTNYGSGE
1810 1820 1830 1840 1850
DENEDEEMEE FEEGPVDVQT SLQANTEATE ENEHDEQVLQ RDFKKTAESK
1860 1870 1880 1890 1900
NVPLEREATS KNDQNNCPVK PCYLNILEDE QPLNSAAHKE SPPTVDSTQQ
1910 1920 1930 1940 1950
PNPLPLRLPE MEPLVPRVKE VKSAQETPES SLAGSPDTES PVLVNDYEAE
1960 1970 1980 1990 2000
SGNISQKSDE EDFVKVEDLP LKLTIYSEAD LRKKMVEEEQ KNHLSGEICE
2010 2020
MQTEELAGNS ETLKEPETVG AQSI
Length:2,024
Mass (Da):228,544
Last modified:March 28, 2018 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4625B991A443B6F3
GO
Isoform 2 (identifier: Q15154-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1315-1370: RYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSE → K

Show »
Length:1,969
Mass (Da):222,233
Checksum:i3FABBC310B106D5C
GO
Isoform 3 (identifier: Q15154-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     263-263: R → RENEEEDVRTIDSAVGSGSVAESTSLNIDVQSEASDTTAR
     492-2024: Missing.

Show »
Length:530
Mass (Da):59,210
Checksum:i43C4D5DC4B4CA24E
GO
Isoform 4 (identifier: Q15154-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     601-601: L → LA
     1315-1370: RYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSE → K
     1838-1947: Missing.

Note: Gene prediction based on EST data.
Show »
Length:1,860
Mass (Da):210,117
Checksum:iCA6CF961CBF52F6B
GO
Isoform 5 (identifier: Q15154-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1556-1563: Missing.

Note: Gene prediction based on EST data.
Show »
Length:2,016
Mass (Da):227,715
Checksum:i3FA93D5214ED7D53
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EV93E7EV93_HUMAN
Pericentriolar material 1 protein
PCM1
749Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBA1H0YBA1_HUMAN
Pericentriolar material 1 protein
PCM1
764Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGQ4E5RGQ4_HUMAN
Pericentriolar material 1 protein
PCM1
408Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PGW9E9PGW9_HUMAN
Pericentriolar material 1 protein
PCM1
530Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH27477 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH65022 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC03656 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAC14882 differs from that shown. Contaminating sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti294R → RG in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti311 – 312EQ → DE in AAA60120 (PubMed:8120099).Curated2
Sequence conflicti405E → K in AAH27477 (PubMed:15489334).Curated1
Sequence conflicti408Q → K in AAH27477 (PubMed:15489334).Curated1
Sequence conflicti408Q → K in AAH65022 (PubMed:15489334).Curated1
Sequence conflicti430A → S in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti447 – 448SV → CL in AAA60120 (PubMed:8120099).Curated2
Sequence conflicti760Q → H in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti946G → R in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti952R → T in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1004Missing in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1086Q → R in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1168Q → R in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1169N → I in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1170S → L in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1342V → L in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1382R → Q in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1532T → A in BAC03656 (PubMed:14702039).Curated1
Sequence conflicti1849S → G in BAC03656 (PubMed:14702039).Curated1
Sequence conflicti1853 – 1864PLERE…SKNDQ → HWNEKPLVKMTK in AAA60120 (PubMed:8120099).CuratedAdd BLAST12
Sequence conflicti1872C → S in AAA60120 (PubMed:8120099).Curated1
Sequence conflicti1988E → V in BAC03656 (PubMed:14702039).Curated1
Sequence conflicti1998I → M in AAA60120 (PubMed:8120099).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_030164159N → SCombined sources2 PublicationsCorresponds to variant dbSNP:rs412750Ensembl.1
Natural variantiVAR_030165176A → D. Corresponds to variant dbSNP:rs2285302Ensembl.1
Natural variantiVAR_030166597M → V1 PublicationCorresponds to variant dbSNP:rs208753Ensembl.1
Natural variantiVAR_047381600S → P. Corresponds to variant dbSNP:rs34325017Ensembl.1
Natural variantiVAR_030167691A → S. Corresponds to variant dbSNP:rs17635381Ensembl.1
Natural variantiVAR_030168871G → V. Corresponds to variant dbSNP:rs7009117Ensembl.1
Natural variantiVAR_0301691251R → H. Corresponds to variant dbSNP:rs17514547Ensembl.1
Natural variantiVAR_0473821326E → D. Corresponds to variant dbSNP:rs34932823Ensembl.1
Natural variantiVAR_0301701543T → I. Corresponds to variant dbSNP:rs370429Ensembl.1
Natural variantiVAR_0473831701K → N. Corresponds to variant dbSNP:rs36113670Ensembl.1
Natural variantiVAR_0473841865N → D. Corresponds to variant dbSNP:rs35789133Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022609263R → RENEEEDVRTIDSAVGSGSV AESTSLNIDVQSEASDTTAR in isoform 3. 1 Publication1
Alternative sequenceiVSP_022610492 – 2024Missing in isoform 3. 1 PublicationAdd BLAST1533
Alternative sequenceiVSP_059399601L → LA in isoform 4. Curated1
Alternative sequenceiVSP_0226111315 – 1370RYESA…EISSE → K in isoform 2 and isoform 4. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0594001556 – 1563Missing in isoform 5. Curated8
Alternative sequenceiVSP_0594011838 – 1947Missing in isoform 4. CuratedAdd BLAST110

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L27841 mRNA Translation: AAA60120.1
AC087273 Genomic DNA No translation available.
AC087625 Genomic DNA No translation available.
KF458696 Genomic DNA No translation available.
BC000453 mRNA Translation: AAH00453.1
BC027477 mRNA Translation: AAH27477.1 Sequence problems.
BC065022 mRNA Translation: AAH65022.1 Sequence problems.
AK091406 mRNA Translation: BAC03656.1 Different initiation.
AJ297349 mRNA Translation: CAC14882.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47812.1 [Q15154-1]
CCDS83255.1 [Q15154-4]
CCDS83256.1 [Q15154-5]
CCDS87582.1 [Q15154-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A54103

NCBI Reference Sequences

More...
RefSeqi
NP_001302437.1, NM_001315508.1
NP_006188.3, NM_006197.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.491148

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325083; ENSP00000327077; ENSG00000078674

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5108

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5108

UCSC genome browser

More...
UCSCi
uc003wyi.5 human [Q15154-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27841 mRNA Translation: AAA60120.1
AC087273 Genomic DNA No translation available.
AC087625 Genomic DNA No translation available.
KF458696 Genomic DNA No translation available.
BC000453 mRNA Translation: AAH00453.1
BC027477 mRNA Translation: AAH27477.1 Sequence problems.
BC065022 mRNA Translation: AAH65022.1 Sequence problems.
AK091406 mRNA Translation: BAC03656.1 Different initiation.
AJ297349 mRNA Translation: CAC14882.1 Sequence problems.
CCDSiCCDS47812.1 [Q15154-1]
CCDS83255.1 [Q15154-4]
CCDS83256.1 [Q15154-5]
CCDS87582.1 [Q15154-3]
PIRiA54103
RefSeqiNP_001302437.1, NM_001315508.1
NP_006188.3, NM_006197.3
UniGeneiHs.491148

3D structure databases

ProteinModelPortaliQ15154
SMRiQ15154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111139, 293 interactors
CORUMiQ15154
DIPiDIP-42189N
IntActiQ15154, 282 interactors
MINTiQ15154
STRINGi9606.ENSP00000327077

Protein family/group databases

MoonDBiQ15154 Predicted

PTM databases

CarbonylDBiQ15154
iPTMnetiQ15154
PhosphoSitePlusiQ15154

Polymorphism and mutation databases

BioMutaiPCM1
DMDMi296439495

Proteomic databases

EPDiQ15154
jPOSTiQ15154
PaxDbiQ15154
PeptideAtlasiQ15154
PRIDEiQ15154
ProteomicsDBi60471
60472 [Q15154-2]
60473 [Q15154-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5108
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325083; ENSP00000327077; ENSG00000078674
GeneIDi5108
KEGGihsa:5108
UCSCiuc003wyi.5 human [Q15154-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5108
DisGeNETi5108
EuPathDBiHostDB:ENSG00000078674.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PCM1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0007341
HGNCiHGNC:8727 PCM1
HPAiCAB058695
HPA023370
HPA023374
MalaCardsiPCM1
MIMi600299 gene
neXtProtiNX_Q15154
Orphaneti146 Differentiated thyroid carcinoma
PharmGKBiPA33073

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEGR Eukaryota
ENOG410YNFX LUCA
HOGENOMiHOG000115473
HOVERGENiHBG053890
InParanoidiQ15154
KOiK16537
OrthoDBi500021at2759
PhylomeDBiQ15154
TreeFamiTF328740

Enzyme and pathway databases

ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-8854518 AURKA Activation by TPX2
SIGNORiQ15154

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PCM1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PCM1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5108

Protein Ontology

More...
PROi
PR:Q15154

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000078674 Expressed in 232 organ(s), highest expression level in testis
CleanExiHS_PCM1
ExpressionAtlasiQ15154 baseline and differential
GenevisibleiQ15154 HS

Family and domain databases

InterProiView protein in InterPro
IPR031446 PCM1_C
IPR024138 Pericentriolar_Pcm1
PANTHERiPTHR14164 PTHR14164, 1 hit
PfamiView protein in Pfam
PF15717 PCM1_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCM1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15154
Secondary accession number(s): A6NNN6
, B4DYD5, E7ETA6, E7EV56, Q58F13, Q6P1K7, Q8NB85, Q9BWC1, Q9H4A2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: March 28, 2018
Last modified: January 16, 2019
This is version 152 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again