Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 225 (16 Oct 2019)
Sequence version 3 (14 Oct 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Plectin

Gene

PLEC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the filaments network, but also in the regulation of their dynamics. Structural component of muscle. Isoform 9 plays a major role in the maintenance of myofiber integrity.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2022090 Assembly of collagen fibrils and other multimeric structures
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-446107 Type I hemidesmosome assembly

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q15149

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plectin
Short name:
PCN
Short name:
PLTN
Alternative name(s):
Hemidesmosomal protein 1
Short name:
HD1
Plectin-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLEC
Synonyms:PLEC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9069 PLEC

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601282 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15149

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Epidermolysis bullosa simplex with pyloric atresia (EBS-PA)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAutosomal recessive genodermatosis characterized by severe skin blistering at birth and congenital pyloric atresia. Death usually occurs in infancy. This disorder is allelic to MD-EBS.
Related information in OMIM
Epidermolysis bullosa simplex, with muscular dystrophy (MD-EBS)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epidermolysis bullosa characterized by the association of blister formation at the level of the hemidesmosome with late-onset muscular dystrophy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_011336429L → LL in MD-EBS. 1 Publication1
Natural variantiVAR_0113371003 – 1005Missing in MD-EBS. 1 Publication3
Epidermolysis bullosa simplex, Ogna type (O-EBS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of intraepidermal epidermolysis bullosa characterized by generalized skin bruising, skin fragility with non-scarring blistering and small hemorrhagic blisters on hands. At the ultrastructural level, it is differentiated from classical cases of K-EBS, WC-EBS and DM-EBS, by the occurrence of blisters originating in basal cells above hemidesmosomes, and abnormal hemidesmosome intracellular attachment plates.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0158172110R → W in O-EBS. 1 PublicationCorresponds to variant dbSNP:rs80338756Ensembl.1
Muscular dystrophy, limb-girdle, autosomal recessive 17 (LGMDR17)3 Publications
The disease is caused by mutations affecting the gene represented in this entry. A 9 bp deletion containing the initiation codon in exon 1f of PLEC have been found in limb-girdle muscular dystrophy patients. The mutation results in deficient expression of isoform 9 and disorganization of the myofibers, without any effect on the skin.
Disease descriptionA form of limb-girdle muscular dystrophy characterized by early childhood onset of proximal muscle weakness. Limb-girdle muscular dystrophies are characterized by proximal weakness, weakness of the hip and shoulder girdles and prominent asymmetrical quadriceps femoris and biceps brachii atrophy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0765653945G → S in LGMDR17. 2 Publications1
Epidermolysis bullosa simplex with nail dystrophy (EBSND)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epidermolysis bullosa, a dermatologic disorder characterized by skin blistering. EBSND patients also manifest nail dystrophy.
Related information in OMIM

Keywords - Diseasei

Disease mutation, Epidermolysis bullosa, Limb-girdle muscular dystrophy

Organism-specific databases

DisGeNET

More...
DisGeNETi
5339

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
PLEC

MalaCards human disease database

More...
MalaCardsi
PLEC
MIMi131950 phenotype
226670 phenotype
612138 phenotype
613723 phenotype
616487 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000178209

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
254361 Autosomal recessive limb-girdle muscular dystrophy type 2Q
257 Epidermolysis bullosa simplex with muscular dystrophy
158684 Epidermolysis bullosa simplex with pyloric atresia
79401 Epidermolysis bullosa simplex, Ogna type

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33399

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q15149

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1293240

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLEC

Domain mapping of disease mutations (DMDM)

More...
DMDMi
209572726

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000781351 – 4684PlectinAdd BLAST4684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei113PhosphothreonineCombined sources1
Modified residuei125PhosphoserineCombined sources1
Modified residuei149PhosphoserineCombined sources1
Modified residuei720PhosphoserineCombined sources1
Modified residuei1047PhosphoserineCombined sources1
Modified residuei1435PhosphoserineCombined sources1
Modified residuei1721PhosphoserineCombined sources1
Modified residuei1725N6-acetyllysineBy similarity1
Modified residuei1732PhosphoserineCombined sources1
Modified residuei2631PhosphoserineCombined sources1
Modified residuei2636N6-acetyllysineBy similarity1
Modified residuei2782PhosphoserineCombined sources1
Modified residuei2802PhosphoserineCombined sources1
Modified residuei2886PhosphothreonineCombined sources1
Modified residuei3033PhosphotyrosineBy similarity1
Modified residuei3036PhosphoserineCombined sources1
Modified residuei3053N6-acetyllysineBy similarity1
Modified residuei3091N6-acetyllysineCombined sources1
Modified residuei3362PhosphotyrosineBy similarity1
Modified residuei3420N6-acetyllysineCombined sources1
Modified residuei3580PhosphoserineBy similarity1
Modified residuei3785PhosphothreonineCombined sources1
Modified residuei4030PhosphothreonineCombined sources1
Modified residuei4054PhosphoserineCombined sources1
Modified residuei4382PhosphoserineCombined sources1
Modified residuei4384PhosphoserineBy similarity1
Modified residuei4385PhosphoserineCombined sources1 Publication1
Modified residuei4386PhosphoserineCombined sources1
Modified residuei4389PhosphoserineCombined sources1
Modified residuei4390PhosphoserineCombined sources1
Modified residuei4391PhosphoserineCombined sources1
Modified residuei4392PhosphoserineCombined sources1
Modified residuei4393PhosphotyrosineCombined sources1
Modified residuei4396PhosphoserineCombined sources1
Modified residuei4400PhosphoserineCombined sources1
Modified residuei4406PhosphoserineBy similarity1
Modified residuei4411PhosphothreonineCombined sources1
Modified residuei4539Phosphothreonine; by CDK1By similarity1
Modified residuei4607PhosphoserineCombined sources1
Modified residuei4613PhosphoserineCombined sources1
Modified residuei4615PhosphotyrosineBy similarity1
Modified residuei4616PhosphoserineCombined sources1
Modified residuei4618PhosphoserineCombined sources1
Modified residuei4622PhosphoserineCombined sources1
Modified residuei4623PhosphothreonineBy similarity1
Modified residuei4626PhosphoserineCombined sources1
Modified residuei4627Omega-N-methylarginineBy similarity1
Modified residuei4640Omega-N-methylarginineCombined sources1
Modified residuei4642PhosphoserineCombined sources1
Modified residuei4672PhosphoserineCombined sources1
Modified residuei4675PhosphoserineCombined sources1
Isoform 4 (identifier: Q15149-4)
Modified residuei20PhosphoserineCombined sourcesBy similarity1
Modified residuei21PhosphoserineCombined sourcesBy similarity1
Modified residuei26Phosphotyrosine By similarityCombined sourcesBy similarity1
Isoform 2 (identifier: Q15149-2)
Modified residuei42PhosphoserineCombined sources1
Isoform 3 (identifier: Q15149-3)
Modified residuei42PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CDK1; regulates dissociation from intermediate filaments during mitosis.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-564
CPTAC-565

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15149

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15149

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q15149

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15149

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15149

PeptideAtlas

More...
PeptideAtlasi
Q15149

PRoteomics IDEntifications database

More...
PRIDEi
Q15149

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60462 [Q15149-1]
60463 [Q15149-2]
60464 [Q15149-3]
60465 [Q15149-4]
60466 [Q15149-5]
60467 [Q15149-6]
60468 [Q15149-7]
60469 [Q15149-8]
60470 [Q15149-9]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q15149

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15149

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15149

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q15149

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in muscle, heart, placenta and spinal cord.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000178209 Expressed in 237 organ(s), highest expression level in quadriceps femoris

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15149 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15149 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003847
HPA025967
HPA029906

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer or homotetramer.

Interacts (via actin-binding domain) with SYNE3.

Interacts (via calponin-homology (CH) 1 domain) with VIM (via rod region) (By similarity).

Interacts (via N-terminus) with DST isoform 2 (via N-terminus) (PubMed:19932097).

Interacts with FER.

Interacts with TOR1A (PubMed:18827015).

Interacts with ANK3 (PubMed:21223964). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity).

Interacts with COL17A1 (PubMed:12482924).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111355, 146 interactors

Protein interaction database and analysis system

More...
IntActi
Q15149, 165 interactors

Molecular INTeraction database

More...
MINTi
Q15149

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000323856

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q15149

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

14684
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15149

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15149

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini179 – 282Calponin-homology (CH) 1PROSITE-ProRule annotationAdd BLAST104
Domaini295 – 400Calponin-homology (CH) 2PROSITE-ProRule annotationAdd BLAST106
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati645 – 710Spectrin 1Add BLAST66
Repeati740 – 824Spectrin 2Add BLAST85
Repeati837 – 930Spectrin 3Add BLAST94
Domaini941 – 998SH3PROSITE-ProRule annotationAdd BLAST58
Repeati1315 – 1415Spectrin 4Add BLAST101
Repeati2826 – 2863Plectin 1Add BLAST38
Repeati2864 – 2901Plectin 2Add BLAST38
Repeati2902 – 2939Plectin 3Add BLAST38
Repeati2940 – 2977Plectin 4Add BLAST38
Repeati2981 – 3015Plectin 5Add BLAST35
Repeati3116 – 3153Plectin 6Add BLAST38
Repeati3154 – 3191Plectin 7Add BLAST38
Repeati3192 – 3229Plectin 8Add BLAST38
Repeati3230 – 3267Plectin 9Add BLAST38
Repeati3268 – 3305Plectin 10Add BLAST38
Repeati3306 – 3343Plectin 11Add BLAST38
Repeati3485 – 3522Plectin 12Add BLAST38
Repeati3523 – 3560Plectin 13Add BLAST38
Repeati3561 – 3598Plectin 14Add BLAST38
Repeati3599 – 3636Plectin 15Add BLAST38
Repeati3640 – 3674Plectin 16Add BLAST35
Repeati3820 – 3857Plectin 17Add BLAST38
Repeati3858 – 3895Plectin 18Add BLAST38
Repeati3896 – 3933Plectin 19Add BLAST38
Repeati3934 – 3971Plectin 20Add BLAST38
Repeati3975 – 4008Plectin 21Add BLAST34
Repeati4063 – 4100Plectin 22Add BLAST38
Repeati4101 – 4138Plectin 23Add BLAST38
Repeati4139 – 4176Plectin 24Add BLAST38
Repeati4177 – 4214Plectin 25Add BLAST38
Repeati4218 – 4252Plectin 26Add BLAST35
Repeati4265 – 4305Plectin 27Add BLAST41
Repeati4319 – 4356Plectin 28Add BLAST38
Repeati4408 – 4445Plectin 29Add BLAST38
Repeati4446 – 4483Plectin 30Add BLAST38
Repeati4484 – 4521Plectin 31Add BLAST38
Repeati4522 – 4559Plectin 32Add BLAST38
Repeati4560 – 4597Plectin 33Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 1470Globular 1Add BLAST1470
Regioni175 – 400Actin-bindingAdd BLAST226
Regioni1471 – 2755Central fibrous rod domainAdd BLAST1285
Regioni2756 – 4684Globular 2Add BLAST1929
Regioni4250 – 4300Binding to intermediate filamentsBy similarityAdd BLAST51
Regioni4625 – 46404 X 4 AA tandem repeats of G-S-R-XAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1469 – 2756Sequence analysisAdd BLAST1288

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the plakin or cytolinker family.Curated

Keywords - Domaini

Coiled coil, Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0516 Eukaryota
KOG3344 Eukaryota
COG5045 LUCA
COG5069 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159045

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15149

KEGG Orthology (KO)

More...
KOi
K10388

Identification of Orthologs from Complete Genome Data

More...
OMAi
MTIWELI

Database of Orthologous Groups

More...
OrthoDBi
738339at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15149

TreeFam database of animal gene trees

More...
TreeFami
TF335163

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014 CH, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit
1.10.418.10, 2 hits
3.90.1290.10, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001589 Actinin_actin-bd_CS
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR041615 Desmoplakin_SH3
IPR041573 Desmoplakin_Spectrin-like
IPR035915 Plakin_repeat_sf
IPR030269 Plectin
IPR001101 Plectin_repeat
IPR005326 S10_plectin_N
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR036388 WH-like_DNA-bd_sf

The PANTHER Classification System

More...
PANTHERi
PTHR23169:SF20 PTHR23169:SF20, 3 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 2 hits
PF00681 Plectin, 18 hits
PF03501 S10_plectin, 1 hit
PF17902 SH3_10, 1 hit
PF18373 Spectrin_like, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 2 hits
SM00250 PLEC, 32 hits
SM00150 SPEC, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit
SSF75399 SSF75399, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00019 ACTININ_1, 1 hit
PS00020 ACTININ_2, 1 hit
PS50021 CH, 2 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15149-1) [UniParc]FASTAAdd to basket
Also known as: Plectin-6

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVAGMLMPRD QLRAIYEVLF REGVMVAKKD RRPRSLHPHV PGVTNLQVMR
60 70 80 90 100
AMASLRARGL VRETFAWCHF YWYLTNEGIA HLRQYLHLPP EIVPASLQRV
110 120 130 140 150
RRPVAMVMPA RRTPHVQAVQ GPLGSPPKRG PLPTEEQRVY RRKELEEVSP
160 170 180 190 200
ETPVVPATTQ RTLARPGPEP APATDERDRV QKKTFTKWVN KHLIKAQRHI
210 220 230 240 250
SDLYEDLRDG HNLISLLEVL SGDSLPREKG RMRFHKLQNV QIALDYLRHR
260 270 280 290 300
QVKLVNIRND DIADGNPKLT LGLIWTIILH FQISDIQVSG QSEDMTAKEK
310 320 330 340 350
LLLWSQRMVE GYQGLRCDNF TSSWRDGRLF NAIIHRHKPL LIDMNKVYRQ
360 370 380 390 400
TNLENLDQAF SVAERDLGVT RLLDPEDVDV PQPDEKSIIT YVSSLYDAMP
410 420 430 440 450
RVPDVQDGVR ANELQLRWQE YRELVLLLLQ WMRHHTAAFE ERRFPSSFEE
460 470 480 490 500
IEILWSQFLK FKEMELPAKE ADKNRSKGIY QSLEGAVQAG QLKVPPGYHP
510 520 530 540 550
LDVEKEWGKL HVAILEREKQ LRSEFERLEC LQRIVTKLQM EAGLCEEQLN
560 570 580 590 600
QADALLQSDV RLLAAGKVPQ RAGEVERDLD KADSMIRLLF NDVQTLKDGR
610 620 630 640 650
HPQGEQMYRR VYRLHERLVA IRTEYNLRLK AGVAAPATQV AQVTLQSVQR
660 670 680 690 700
RPELEDSTLR YLQDLLAWVE ENQHRVDGAE WGVDLPSVEA QLGSHRGLHQ
710 720 730 740 750
SIEEFRAKIE RARSDEGQLS PATRGAYRDC LGRLDLQYAK LLNSSKARLR
760 770 780 790 800
SLESLHSFVA AATKELMWLN EKEEEEVGFD WSDRNTNMTA KKESYSALMR
810 820 830 840 850
ELELKEKKIK ELQNAGDRLL REDHPARPTV ESFQAALQTQ WSWMLQLCCC
860 870 880 890 900
IEAHLKENAA YFQFFSDVRE AEGQLQKLQE ALRRKYSCDR SATVTRLEDL
910 920 930 940 950
LQDAQDEKEQ LNEYKGHLSG LAKRAKAVVQ LKPRHPAHPM RGRLPLLAVC
960 970 980 990 1000
DYKQVEVTVH KGDECQLVGP AQPSHWKVLS SSGSEAAVPS VCFLVPPPNQ
1010 1020 1030 1040 1050
EAQEAVTRLE AQHQALVTLW HQLHVDMKSL LAWQSLRRDV QLIRSWSLAT
1060 1070 1080 1090 1100
FRTLKPEEQR QALHSLELHY QAFLRDSQDA GGFGPEDRLM AEREYGSCSH
1110 1120 1130 1140 1150
HYQQLLQSLE QGAQEESRCQ RCISELKDIR LQLEACETRT VHRLRLPLDK
1160 1170 1180 1190 1200
EPARECAQRI AEQQKAQAEV EGLGKGVARL SAEAEKVLAL PEPSPAAPTL
1210 1220 1230 1240 1250
RSELELTLGK LEQVRSLSAI YLEKLKTISL VIRGTQGAEE VLRAHEEQLK
1260 1270 1280 1290 1300
EAQAVPATLP ELEATKASLK KLRAQAEAQQ PTFDALRDEL RGAQEVGERL
1310 1320 1330 1340 1350
QQRHGERDVE VERWRERVAQ LLERWQAVLA QTDVRQRELE QLGRQLRYYR
1360 1370 1380 1390 1400
ESADPLGAWL QDARRRQEQI QAMPLADSQA VREQLRQEQA LLEEIERHGE
1410 1420 1430 1440 1450
KVEECQRFAK QYINAIKDYE LQLVTYKAQL EPVASPAKKP KVQSGSESVI
1460 1470 1480 1490 1500
QEYVDLRTHY SELTTLTSQY IKFISETLRR MEEEERLAEQ QRAEERERLA
1510 1520 1530 1540 1550
EVEAALEKQR QLAEAHAQAK AQAEREAKEL QQRMQEEVVR REEAAVDAQQ
1560 1570 1580 1590 1600
QKRSIQEELQ QLRQSSEAEI QAKARQAEAA ERSRLRIEEE IRVVRLQLEA
1610 1620 1630 1640 1650
TERQRGGAEG ELQALRARAE EAEAQKRQAQ EEAERLRRQV QDESQRKRQA
1660 1670 1680 1690 1700
EVELASRVKA EAEAAREKQR ALQALEELRL QAEEAERRLR QAEVERARQV
1710 1720 1730 1740 1750
QVALETAQRS AEAELQSKRA SFAEKTAQLE RSLQEEHVAV AQLREEAERR
1760 1770 1780 1790 1800
AQQQAEAERA REEAERELER WQLKANEALR LRLQAEEVAQ QKSLAQAEAE
1810 1820 1830 1840 1850
KQKEEAEREA RRRGKAEEQA VRQRELAEQE LEKQRQLAEG TAQQRLAAEQ
1860 1870 1880 1890 1900
ELIRLRAETE QGEQQRQLLE EELARLQREA AAATQKRQEL EAELAKVRAE
1910 1920 1930 1940 1950
MEVLLASKAR AEEESRSTSE KSKQRLEAEA GRFRELAEEA ARLRALAEEA
1960 1970 1980 1990 2000
KRQRQLAEED AARQRAEAER VLAEKLAAIG EATRLKTEAE IALKEKEAEN
2010 2020 2030 2040 2050
ERLRRLAEDE AFQRRRLEEQ AAQHKADIEE RLAQLRKASD SELERQKGLV
2060 2070 2080 2090 2100
EDTLRQRRQV EEEILALKAS FEKAAAGKAE LELELGRIRS NAEDTLRSKE
2110 2120 2130 2140 2150
QAELEAARQR QLAAEEERRR REAEERVQKS LAAEEEAARQ RKAALEEVER
2160 2170 2180 2190 2200
LKAKVEEARR LRERAEQESA RQLQLAQEAA QKRLQAEEKA HAFAVQQKEQ
2210 2220 2230 2240 2250
ELQQTLQQEQ SVLDQLRGEA EAARRAAEEA EEARVQAERE AAQSRRQVEE
2260 2270 2280 2290 2300
AERLKQSAEE QAQARAQAQA AAEKLRKEAE QEAARRAQAE QAALRQKQAA
2310 2320 2330 2340 2350
DAEMEKHKKF AEQTLRQKAQ VEQELTTLRL QLEETDHQKN LLDEELQRLK
2360 2370 2380 2390 2400
AEATEAARQR SQVEEELFSV RVQMEELSKL KARIEAENRA LILRDKDNTQ
2410 2420 2430 2440 2450
RFLQEEAEKM KQVAEEAARL SVAAQEAARL RQLAEEDLAQ QRALAEKMLK
2460 2470 2480 2490 2500
EKMQAVQEAT RLKAEAELLQ QQKELAQEQA RRLQEDKEQM AQQLAEETQG
2510 2520 2530 2540 2550
FQRTLEAERQ RQLEMSAEAE RLKLRVAEMS RAQARAEEDA QRFRKQAEEI
2560 2570 2580 2590 2600
GEKLHRTELA TQEKVTLVQT LEIQRQQSDH DAERLREAIA ELEREKEKLQ
2610 2620 2630 2640 2650
QEAKLLQLKS EEMQTVQQEQ LLQETQALQQ SFLSEKDSLL QRERFIEQEK
2660 2670 2680 2690 2700
AKLEQLFQDE VAKAQQLREE QQRQQQQMEQ ERQRLVASME EARRRQHEAE
2710 2720 2730 2740 2750
EGVRRKQEEL QQLEQQRRQQ EELLAEENQR LREQLQLLEE QHRAALAHSE
2760 2770 2780 2790 2800
EVTASQVAAT KTLPNGRDAL DGPAAEAEPE HSFDGLRRKV SAQRLQEAGI
2810 2820 2830 2840 2850
LSAEELQRLA QGHTTVDELA RREDVRHYLQ GRSSIAGLLL KATNEKLSVY
2860 2870 2880 2890 2900
AALQRQLLSP GTALILLEAQ AASGFLLDPV RNRRLTVNEA VKEGVVGPEL
2910 2920 2930 2940 2950
HHKLLSAERA VTGYKDPYTG QQISLFQAMQ KGLIVREHGI RLLEAQIATG
2960 2970 2980 2990 3000
GVIDPVHSHR VPVDVAYRRG YFDEEMNRVL ADPSDDTKGF FDPNTHENLT
3010 3020 3030 3040 3050
YLQLLERCVE DPETGLCLLP LTDKAAKGGE LVYTDSEARD VFEKATVSAP
3060 3070 3080 3090 3100
FGKFQGKTVT IWEIINSEYF TAEQRRDLLR QFRTGRITVE KIIKIIITVV
3110 3120 3130 3140 3150
EEQEQKGRLC FEGLRSLVPA AELLESRVID RELYQQLQRG ERSVRDVAEV
3160 3170 3180 3190 3200
DTVRRALRGA NVIAGVWLEE AGQKLSIYNA LKKDLLPSDM AVALLEAQAG
3210 3220 3230 3240 3250
TGHIIDPATS ARLTVDEAVR AGLVGPEFHE KLLSAEKAVT GYRDPYTGQS
3260 3270 3280 3290 3300
VSLFQALKKG LIPREQGLRL LDAQLSTGGI VDPSKSHRVP LDVACARGCL
3310 3320 3330 3340 3350
DEETSRALSA PRADAKAYSD PSTGEPATYG ELQQRCRPDQ LTGLSLLPLS
3360 3370 3380 3390 3400
EKAARARQEE LYSELQARET FEKTPVEVPV GGFKGRTVTV WELISSEYFT
3410 3420 3430 3440 3450
AEQRQELLRQ FRTGKVTVEK VIKILITIVE EVETLRQERL SFSGLRAPVP
3460 3470 3480 3490 3500
ASELLASGVL SRAQFEQLKD GKTTVKDLSE LGSVRTLLQG SGCLAGIYLE
3510 3520 3530 3540 3550
DTKEKVSIYE AMRRGLLRAT TAALLLEAQA ATGFLVDPVR NQRLYVHEAV
3560 3570 3580 3590 3600
KAGVVGPELH EQLLSAEKAV TGYRDPYSGS TISLFQAMQK GLVLRQHGIR
3610 3620 3630 3640 3650
LLEAQIATGG IIDPVHSHRV PVDVAYQRGY FSEEMNRVLA DPSDDTKGFF
3660 3670 3680 3690 3700
DPNTHENLTY RQLLERCVED PETGLRLLPL KGAEKAEVVE TTQVYTEEET
3710 3720 3730 3740 3750
RRAFEETQID IPGGGSHGGS TMSLWEVMQS DLIPEEQRAQ LMADFQAGRV
3760 3770 3780 3790 3800
TKERMIIIII EIIEKTEIIR QQGLASYDYV RRRLTAEDLF EARIISLETY
3810 3820 3830 3840 3850
NLLREGTRSL REALEAESAW CYLYGTGSVA GVYLPGSRQT LSIYQALKKG
3860 3870 3880 3890 3900
LLSAEVARLL LEAQAATGFL LDPVKGERLT VDEAVRKGLV GPELHDRLLS
3910 3920 3930 3940 3950
AERAVTGYRD PYTEQTISLF QAMKKELIPT EEALRLLDAQ LATGGIVDPR
3960 3970 3980 3990 4000
LGFHLPLEVA YQRGYLNKDT HDQLSEPSEV RSYVDPSTDE RLSYTQLLRR
4010 4020 4030 4040 4050
CRRDDGTGQL LLPLSDARKL TFRGLRKQIT MEELVRSQVM DEATALQLRE
4060 4070 4080 4090 4100
GLTSIEEVTK NLQKFLEGTS CIAGVFVDAT KERLSVYQAM KKGIIRPGTA
4110 4120 4130 4140 4150
FELLEAQAAT GYVIDPIKGL KLTVEEAVRM GIVGPEFKDK LLSAERAVTG
4160 4170 4180 4190 4200
YKDPYSGKLI SLFQAMKKGL ILKDHGIRLL EAQIATGGII DPEESHRLPV
4210 4220 4230 4240 4250
EVAYKRGLFD EEMNEILTDP SDDTKGFFDP NTEENLTYLQ LMERCITDPQ
4260 4270 4280 4290 4300
TGLCLLPLKE KKRERKTSSK SSVRKRRVVI VDPETGKEMS VYEAYRKGLI
4310 4320 4330 4340 4350
DHQTYLELSE QECEWEEITI SSSDGVVKSM IIDRRSGRQY DIDDAIAKNL
4360 4370 4380 4390 4400
IDRSALDQYR AGTLSITEFA DMLSGNAGGF RSRSSSVGSS SSYPISPAVS
4410 4420 4430 4440 4450
RTQLASWSDP TEETGPVAGI LDTETLEKVS ITEAMHRNLV DNITGQRLLE
4460 4470 4480 4490 4500
AQACTGGIID PSTGERFPVT DAVNKGLVDK IMVDRINLAQ KAFCGFEDPR
4510 4520 4530 4540 4550
TKTKMSAAQA LKKGWLYYEA GQRFLEVQYL TGGLIEPDTP GRVPLDEALQ
4560 4570 4580 4590 4600
RGTVDARTAQ KLRDVGAYSK YLTCPKTKLK ISYKDALDRS MVEEGTGLRL
4610 4620 4630 4640 4650
LEAAAQSTKG YYSPYSVSGS GSTAGSRTGS RTGSRAGSRR GSFDATGSGF
4660 4670 4680
SMTFSSSSYS SSGYGRRYAS GSSASLGGPE SAVA
Length:4,684
Mass (Da):531,791
Last modified:October 14, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i04772E4F70A304C8
GO
Isoform 2 (identifier: Q15149-2) [UniParc]FASTAAdd to basket
Also known as: Plectin-1, 1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA

Show »
Length:4,574
Mass (Da):518,473
Checksum:i7EAEA5A83DEF52EA
GO
Isoform 3 (identifier: Q15149-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA
     409-412: Missing.

Show »
Length:4,570
Mass (Da):518,032
Checksum:iA0AF260B8C095C8D
GO
Isoform 4 (identifier: Q15149-4) [UniParc]FASTAAdd to basket
Also known as: Plectin-11, 1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSQHQLRVPQ...AVLRASEGKK

Show »
Length:4,547
Mass (Da):516,198
Checksum:i0A1A2AB2E557110A
GO
Isoform 5 (identifier: Q15149-5) [UniParc]FASTAAdd to basket
Also known as: Plectin-8, 1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-137: Missing.
     138-174: RVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPAT → MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQ

Show »
Length:4,547
Mass (Da):516,276
Checksum:i0EC98F109B723779
GO
Isoform 6 (identifier: Q15149-6) [UniParc]FASTAAdd to basket
Also known as: Plectin-10, 1g

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     134-174: TEEQRVYRRK...RPGPEPAPAT → MSGAGGAFAS...GYLYQQLCCV

Show »
Length:4,551
Mass (Da):516,479
Checksum:iC2E0FDA51BC17BF2
GO
Isoform 7 (identifier: Q15149-7) [UniParc]FASTAAdd to basket
Also known as: Plectin-7, 1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-169: Missing.
     170-174: PAPAT → MKIVP

Show »
Length:4,515
Mass (Da):512,604
Checksum:iC8701AD6D1C1B26E
GO
Isoform 8 (identifier: Q15149-8) [UniParc]FASTAAdd to basket
Also known as: Plectin-3, 1e

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-174: QRTLARPGPEPAPAT → MDPSRAIQNEISSLK

Show »
Length:4,525
Mass (Da):513,706
Checksum:i37A4DFAB46C3B4DD
GO
Isoform 9 (identifier: Q15149-9) [UniParc]FASTAAdd to basket
Also known as: Plectin-2, 1f

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     152-174: TPVVPATTQRTLARPGPEPAPAT → MAGPLPDEQDFIQAYEEVREKYK

Show »
Length:4,533
Mass (Da):514,775
Checksum:i5D6382389A66B955
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDN1H0YDN1_HUMAN
Plectin
PLEC
3,447Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMV1E9PMV1_HUMAN
Plectin
PLEC
703Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKG0E9PKG0_HUMAN
Plectin
PLEC
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIA2E9PIA2_HUMAN
Plectin
PLEC
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ28E9PQ28_HUMAN
Plectin
PLEC
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti71Y → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti94P → A in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti139V → L in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti185F → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti259N → D in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti259N → D in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti550N → H in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti560V → I in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti706R → Q in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti886Y → N in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1002A → V in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1309V → L in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1309V → L in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1334V → L in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1334V → L in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1534M → I in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1662A → T in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1662A → T in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1688 – 1690RLR → WLC in CAA91196 (PubMed:8633055).Curated3
Sequence conflicti1767E → Q in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1789A → L in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1910R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2154K → N in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in CAA65765 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in AAR95680 (PubMed:14672974).Curated1
Sequence conflicti2154K → N in AAR95682 (PubMed:14672974).Curated1
Sequence conflicti2154K → N in AAR95683 (PubMed:14672974).Curated1
Sequence conflicti2160R → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2215Q → R in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2244S → A in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2244S → A in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti2244S → A in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti2244S → A in CAA65765 (PubMed:8698233).Curated1
Sequence conflicti3027K → E in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti3027K → E in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti3310A → E in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3361L → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3408L → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3447A → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3531A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3580S → R in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3589Q → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3596Q → E in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3616H → N in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3686A → V in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3786A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3808R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3816A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3821C → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3915Q → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3999R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti4007T → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti4467F → L in CAA91196 (PubMed:8633055).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075706102R → H1 PublicationCorresponds to variant dbSNP:rs200335928Ensembl.1
Natural variantiVAR_011336429L → LL in MD-EBS. 1 Publication1
Natural variantiVAR_053585641A → V. Corresponds to variant dbSNP:rs11136336Ensembl.1
Natural variantiVAR_0113371003 – 1005Missing in MD-EBS. 1 Publication3
Natural variantiVAR_0600881321L → V1 PublicationCorresponds to variant dbSNP:rs3135109Ensembl.1
Natural variantiVAR_0600891386R → Q. Corresponds to variant dbSNP:rs11136334Ensembl.1
Natural variantiVAR_0621331459H → R. Corresponds to variant dbSNP:rs55895668Ensembl.1
Natural variantiVAR_0765642005R → W1 PublicationCorresponds to variant dbSNP:rs200543521Ensembl.1
Natural variantiVAR_0158172110R → W in O-EBS. 1 PublicationCorresponds to variant dbSNP:rs80338756Ensembl.1
Natural variantiVAR_0535862150R → W. Corresponds to variant dbSNP:rs34893635Ensembl.1
Natural variantiVAR_0535872194A → V. Corresponds to variant dbSNP:rs7002002Ensembl.1
Natural variantiVAR_0535882791S → P. Corresponds to variant dbSNP:rs7833924Ensembl.1
Natural variantiVAR_0535892821R → W. Corresponds to variant dbSNP:rs35723243Ensembl.1
Natural variantiVAR_0535902969R → H. Corresponds to variant dbSNP:rs6558407Ensembl.1
Natural variantiVAR_0535913162V → I. Corresponds to variant dbSNP:rs35027700Ensembl.1
Natural variantiVAR_0535923171A → V. Corresponds to variant dbSNP:rs35858667Ensembl.1
Natural variantiVAR_0535933486T → M. Corresponds to variant dbSNP:rs34725742Ensembl.1
Natural variantiVAR_0535943490G → A. Corresponds to variant dbSNP:rs35261863Ensembl.1
Natural variantiVAR_0765653945G → S in LGMDR17. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0050301 – 174MVAGM…PAPAT → MSGEDAEVRAVSEDVSNGSS GSPSPGDTLPWNLGKTQRSR RSGGGAGSNGSVLDPAERAV IRIA in isoform 2 and isoform 3. 2 PublicationsAdd BLAST174
Alternative sequenceiVSP_0235101 – 174MVAGM…PAPAT → MSQHQLRVPQPEGLGRKRTS SEDNLYLAVLRASEGKK in isoform 4. 1 PublicationAdd BLAST174
Alternative sequenceiVSP_0371001 – 169Missing in isoform 7. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_0371011 – 159Missing in isoform 8. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_0371021 – 151Missing in isoform 9. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0371031 – 137Missing in isoform 5. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_0371041 – 133Missing in isoform 6. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_037105134 – 174TEEQR…PAPAT → MSGAGGAFASPREVLLERPC WLDGGCEPARRGYLYQQLCC V in isoform 6. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_037106138 – 174RVYRR…PAPAT → MEPSGSLFPSLVVVGHVVTL AAVWHWRRGRRWAQDEQ in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_037107152 – 174TPVVP…PAPAT → MAGPLPDEQDFIQAYEEVRE KYK in isoform 9. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_037108160 – 174QRTLA…PAPAT → MDPSRAIQNEISSLK in isoform 8. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_037109170 – 174PAPAT → MKIVP in isoform 7. 1 Publication5
Alternative sequenceiVSP_005031409 – 412Missing in isoform 3. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z54367 Genomic DNA Translation: CAA91196.1
U53204 mRNA Translation: AAB05427.1
U63610, U63609 Genomic DNA Translation: AAB05428.1
X97053 mRNA Translation: CAA65765.1
AY480044 mRNA Translation: AAR95677.1
AY480045 mRNA Translation: AAR95678.1
AY480046 mRNA Translation: AAR95679.1
AY480047 mRNA Translation: AAR95680.1
AY480048 mRNA Translation: AAR95681.1
AY480049 mRNA Translation: AAR95682.1
AY480050 mRNA Translation: AAR95683.1
AY480051 mRNA Translation: AAR95684.1
AC109322 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43769.1 [Q15149-2]
CCDS43770.1 [Q15149-9]
CCDS43771.1 [Q15149-8]
CCDS43772.1 [Q15149-1]
CCDS43773.1 [Q15149-5]
CCDS43774.1 [Q15149-6]
CCDS43775.1 [Q15149-4]
CCDS47936.1 [Q15149-7]

Protein sequence database of the Protein Information Resource

More...
PIRi
C59404 A59404
G02520

NCBI Reference Sequences

More...
RefSeqi
NP_000436.2, NM_000445.4 [Q15149-2]
NP_958780.1, NM_201378.3 [Q15149-9]
NP_958781.1, NM_201379.2 [Q15149-8]
NP_958782.1, NM_201380.3 [Q15149-1]
NP_958783.1, NM_201381.2 [Q15149-7]
NP_958784.1, NM_201382.3 [Q15149-5]
NP_958785.1, NM_201383.2 [Q15149-6]
NP_958786.1, NM_201384.2 [Q15149-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000322810; ENSP00000323856; ENSG00000178209 [Q15149-1]
ENST00000345136; ENSP00000344848; ENSG00000178209 [Q15149-4]
ENST00000354589; ENSP00000346602; ENSG00000178209 [Q15149-5]
ENST00000354958; ENSP00000347044; ENSG00000178209 [Q15149-8]
ENST00000356346; ENSP00000348702; ENSG00000178209 [Q15149-9]
ENST00000357649; ENSP00000350277; ENSG00000178209 [Q15149-6]
ENST00000398774; ENSP00000381756; ENSG00000178209 [Q15149-7]
ENST00000436759; ENSP00000388180; ENSG00000178209 [Q15149-2]
ENST00000527096; ENSP00000434583; ENSG00000178209 [Q15149-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5339

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5339

UCSC genome browser

More...
UCSCi
uc003zab.2 human [Q15149-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Plectin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z54367 Genomic DNA Translation: CAA91196.1
U53204 mRNA Translation: AAB05427.1
U63610, U63609 Genomic DNA Translation: AAB05428.1
X97053 mRNA Translation: CAA65765.1
AY480044 mRNA Translation: AAR95677.1
AY480045 mRNA Translation: AAR95678.1
AY480046 mRNA Translation: AAR95679.1
AY480047 mRNA Translation: AAR95680.1
AY480048 mRNA Translation: AAR95681.1
AY480049 mRNA Translation: AAR95682.1
AY480050 mRNA Translation: AAR95683.1
AY480051 mRNA Translation: AAR95684.1
AC109322 Genomic DNA No translation available.
CCDSiCCDS43769.1 [Q15149-2]
CCDS43770.1 [Q15149-9]
CCDS43771.1 [Q15149-8]
CCDS43772.1 [Q15149-1]
CCDS43773.1 [Q15149-5]
CCDS43774.1 [Q15149-6]
CCDS43775.1 [Q15149-4]
CCDS47936.1 [Q15149-7]
PIRiC59404 A59404
G02520
RefSeqiNP_000436.2, NM_000445.4 [Q15149-2]
NP_958780.1, NM_201378.3 [Q15149-9]
NP_958781.1, NM_201379.2 [Q15149-8]
NP_958782.1, NM_201380.3 [Q15149-1]
NP_958783.1, NM_201381.2 [Q15149-7]
NP_958784.1, NM_201382.3 [Q15149-5]
NP_958785.1, NM_201383.2 [Q15149-6]
NP_958786.1, NM_201384.2 [Q15149-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MB8X-ray2.15A175-403[»]
2N03NMR-A4403-4606[»]
2ODUX-ray2.30A410-640[»]
2ODVX-ray2.05A410-640[»]
3F7PX-ray2.75A/B175-403[»]
3PDYX-ray2.22A/B653-858[»]
3PE0X-ray2.95A/B750-1028[»]
4GDOX-ray1.70A/B/C/D/E/F1492-1530[»]
4Q58X-ray4.00A/B175-400[»]
4Q59X-ray2.30A/B175-400[»]
5J1FX-ray3.00A/B860-928[»]
A/B999-1116[»]
5J1GX-ray1.80A/B1114-1343[»]
5J1HX-ray2.80A/B860-928[»]
A/B999-1116[»]
5J1IX-ray2.80A/B1114-1482[»]
SMRiQ15149
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi111355, 146 interactors
IntActiQ15149, 165 interactors
MINTiQ15149
STRINGi9606.ENSP00000323856

Chemistry databases

BindingDBiQ15149
ChEMBLiCHEMBL1293240

PTM databases

CarbonylDBiQ15149
iPTMnetiQ15149
PhosphoSitePlusiQ15149
SwissPalmiQ15149

Polymorphism and mutation databases

BioMutaiPLEC
DMDMi209572726

Proteomic databases

CPTACiCPTAC-564
CPTAC-565
EPDiQ15149
jPOSTiQ15149
MassIVEiQ15149
MaxQBiQ15149
PaxDbiQ15149
PeptideAtlasiQ15149
PRIDEiQ15149
ProteomicsDBi60462 [Q15149-1]
60463 [Q15149-2]
60464 [Q15149-3]
60465 [Q15149-4]
60466 [Q15149-5]
60467 [Q15149-6]
60468 [Q15149-7]
60469 [Q15149-8]
60470 [Q15149-9]

Genome annotation databases

EnsembliENST00000322810; ENSP00000323856; ENSG00000178209 [Q15149-1]
ENST00000345136; ENSP00000344848; ENSG00000178209 [Q15149-4]
ENST00000354589; ENSP00000346602; ENSG00000178209 [Q15149-5]
ENST00000354958; ENSP00000347044; ENSG00000178209 [Q15149-8]
ENST00000356346; ENSP00000348702; ENSG00000178209 [Q15149-9]
ENST00000357649; ENSP00000350277; ENSG00000178209 [Q15149-6]
ENST00000398774; ENSP00000381756; ENSG00000178209 [Q15149-7]
ENST00000436759; ENSP00000388180; ENSG00000178209 [Q15149-2]
ENST00000527096; ENSP00000434583; ENSG00000178209 [Q15149-3]
GeneIDi5339
KEGGihsa:5339
UCSCiuc003zab.2 human [Q15149-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5339
DisGeNETi5339

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLEC
GeneReviewsiPLEC
HGNCiHGNC:9069 PLEC
HPAiCAB003847
HPA025967
HPA029906
MalaCardsiPLEC
MIMi131950 phenotype
226670 phenotype
601282 gene
612138 phenotype
613723 phenotype
616487 phenotype
neXtProtiNX_Q15149
OpenTargetsiENSG00000178209
Orphaneti254361 Autosomal recessive limb-girdle muscular dystrophy type 2Q
257 Epidermolysis bullosa simplex with muscular dystrophy
158684 Epidermolysis bullosa simplex with pyloric atresia
79401 Epidermolysis bullosa simplex, Ogna type
PharmGKBiPA33399

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0516 Eukaryota
KOG3344 Eukaryota
COG5045 LUCA
COG5069 LUCA
GeneTreeiENSGT00940000159045
InParanoidiQ15149
KOiK10388
OMAiMTIWELI
OrthoDBi738339at2759
PhylomeDBiQ15149
TreeFamiTF335163

Enzyme and pathway databases

ReactomeiR-HSA-2022090 Assembly of collagen fibrils and other multimeric structures
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-446107 Type I hemidesmosome assembly
SIGNORiQ15149

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLEC human
EvolutionaryTraceiQ15149

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Plectin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5339
PharosiQ15149

Protein Ontology

More...
PROi
PR:Q15149

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000178209 Expressed in 237 organ(s), highest expression level in quadriceps femoris
ExpressionAtlasiQ15149 baseline and differential
GenevisibleiQ15149 HS

Family and domain databases

CDDicd00014 CH, 2 hits
Gene3Di1.10.10.10, 1 hit
1.10.418.10, 2 hits
3.90.1290.10, 6 hits
InterProiView protein in InterPro
IPR001589 Actinin_actin-bd_CS
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR041615 Desmoplakin_SH3
IPR041573 Desmoplakin_Spectrin-like
IPR035915 Plakin_repeat_sf
IPR030269 Plectin
IPR001101 Plectin_repeat
IPR005326 S10_plectin_N
IPR001452 SH3_domain
IPR018159 Spectrin/alpha-actinin
IPR036388 WH-like_DNA-bd_sf
PANTHERiPTHR23169:SF20 PTHR23169:SF20, 3 hits
PfamiView protein in Pfam
PF00307 CH, 2 hits
PF00681 Plectin, 18 hits
PF03501 S10_plectin, 1 hit
PF17902 SH3_10, 1 hit
PF18373 Spectrin_like, 1 hit
SMARTiView protein in SMART
SM00033 CH, 2 hits
SM00250 PLEC, 32 hits
SM00150 SPEC, 7 hits
SUPFAMiSSF47576 SSF47576, 1 hit
SSF75399 SSF75399, 7 hits
PROSITEiView protein in PROSITE
PS00019 ACTININ_1, 1 hit
PS00020 ACTININ_2, 1 hit
PS50021 CH, 2 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLEC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15149
Secondary accession number(s): Q15148
, Q16640, Q6S376, Q6S377, Q6S378, Q6S379, Q6S380, Q6S381, Q6S382, Q6S383
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: October 14, 2008
Last modified: October 16, 2019
This is version 225 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again