Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

PLCB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei328PROSITE-ProRule annotation1
Active sitei375PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • phosphatidylinositol phospholipase C activity Source: GO_Central
  • phospholipase C activity Source: Reactome

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.11 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112043 PLC beta mediated events
R-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol
R-HSA-416476 G alpha (q) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name:
PLC-beta-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLCB4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000101333.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9059 PLCB4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600810 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15147

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Auriculocondylar syndrome 2 (ARCND2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA craniofacial malformation syndrome characterized by variable mandibular anomalies, including mild to severe micrognathia, temporomandibular joint ankylosis, cleft palate, and a characteristic ear malformation that consists of separation of the lobule from the external ear, giving the appearance of a question mark (question-mark ear). Other frequently described features include prominent cheeks, cupped and posteriorly rotated ears, preauricular tags, and microstomia.
See also OMIM:614669
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_068559329N → T in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs387907179EnsemblClinVar.1
Natural variantiVAR_068560621R → C in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514482EnsemblClinVar.1
Natural variantiVAR_068561621R → H in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514481EnsemblClinVar.1
Natural variantiVAR_068562623Y → C in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514480EnsemblClinVar.1
Natural variantiVAR_068563650N → H in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514483EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
5332

MalaCards human disease database

More...
MalaCardsi
PLCB4
MIMi614669 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000101333

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
137888 Auriculocondylar syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33387

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLCB4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000884952 – 11751-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4Add BLAST1174

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanine1 Publication1
Modified residuei886PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15147

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15147

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15147

PeptideAtlas

More...
PeptideAtlasi
Q15147

PRoteomics IDEntifications database

More...
PRIDEi
Q15147

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60459
60460 [Q15147-2]
60461 [Q15147-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15147

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15147

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q15147

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Preferentially expressed in the retina.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101333 Expressed in 211 organ(s), highest expression level in parotid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15147 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15147 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007951

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
RELQ048643EBI-998637,EBI-307352

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111348, 3 interactors

Database of interacting proteins

More...
DIPi
DIP-36735N

Protein interaction database and analysis system

More...
IntActi
Q15147, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000334105

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15147

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15147

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini313 – 463PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST151
Domaini565 – 681PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini688 – 786C2PROSITE-ProRule annotationAdd BLAST99

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169 Eukaryota
ENOG410XPSW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156426

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232046

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053609

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15147

KEGG Orthology (KO)

More...
KOi
K05858

Identification of Orthologs from Complete Genome Data

More...
OMAi
ERNIHHN

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00XL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15147

TreeFam database of animal gene trees

More...
TreeFami
TF352235

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13361 PH_PLC_beta, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336 PTHR10336, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 1 hit
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000956 PLC-beta, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390 PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q15147-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW
60 70 80 90 100
RSEGKEGQVL ECSLINSIRS GAIPKDPKIL AALEAVGKSE NDLEGRIVCV
110 120 130 140 150
CSGTDLVNIS FTYMVAENPE VTKQWVEGLR SIIHNFRANN VSPMTCLKKH
160 170 180 190 200
WMKLAFMTNT NGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE
210 220 230 240 250
PTAFSYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ
260 270 280 290 300
RDPRLNEILF PFYDAKRAMQ IIEMYEPDED LKKKGLISSD GFCRYLMSDE
310 320 330 340 350
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL
360 370 380 390 400
LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS
410 420 430 440 450
EYPVILSFEN HCSKYQQYKM SKYCEDLFGD LLLKQALESH PLEPGRALPS
460 470 480 490 500
PNDLKRKILI KNKRLKPEVE KKQLEALRSM MEAGESASPA NILEDDNEEE
510 520 530 540 550
IESADQEEEA HPEFKFGNEL SADDLGHKEA VANSVKKGLV TVEDEQAWMA
560 570 580 590 600
SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG
610 620 630 640 650
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN
660 670 680 690 700
YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA
710 720 730 740 750
ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP
760 770 780 790 800
VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS
810 820 830 840 850
LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD
860 870 880 890 900
QMRAMGIETS DIADVPSDTS KNDKKGKANT AKANVTPQSS SELRPTTTAA
910 920 930 940 950
LASGVEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH
960 970 980 990 1000
STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEMKKETEI
1010 1020 1030 1040 1050
KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL
1060 1070 1080 1090 1100
KKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK
1110 1120 1130 1140 1150
AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ
1160 1170
NEQAKEMQQM VKLEAEMDRR PATVV
Length:1,175
Mass (Da):134,464
Last modified:December 5, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB2C8EB99EF57357
GO
Isoform 1 (identifier: Q15147-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-153: Missing.
     154-167: LAFMTNTNGKIPVR → MNNNWNVCFFLFCP

Show »
Length:1,022
Mass (Da):117,162
Checksum:i4A6A14188161A46C
GO
Isoform 3 (identifier: Q15147-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Note: No experimental confirmation available.
Show »
Length:1,194
Mass (Da):136,106
Checksum:iE6A0912E517D182C
GO
Isoform 4 (identifier: Q15147-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: V → VKKASDDLEHENN

Note: No experimental confirmation available.
Show »
Length:1,187
Mass (Da):135,845
Checksum:i8EC5C7445E1052AA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AJW4B1AJW4_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB4
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AJW2B1AJW2_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB4
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AJW3B1AJW3_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB4
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AJW1B1AJW1_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB4
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti447A → P in AAB02027 (PubMed:8530101).Curated1
Sequence conflicti757F → L in AAB02027 (PubMed:8530101).Curated1
Sequence conflicti787L → P in AAB02027 (PubMed:8530101).Curated1
Sequence conflicti840K → T in AAB02027 (PubMed:8530101).Curated1
Sequence conflicti902A → P in AAB02027 (PubMed:8530101).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05669421A → T1 PublicationCorresponds to variant dbSNP:rs6077510EnsemblClinVar.1
Natural variantiVAR_068559329N → T in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs387907179EnsemblClinVar.1
Natural variantiVAR_068560621R → C in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514482EnsemblClinVar.1
Natural variantiVAR_068561621R → H in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514481EnsemblClinVar.1
Natural variantiVAR_068562623Y → C in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514480EnsemblClinVar.1
Natural variantiVAR_068563650N → H in ARCND2. 1 PublicationCorresponds to variant dbSNP:rs397514483EnsemblClinVar.1
Natural variantiVAR_056695710G → S. Corresponds to variant dbSNP:rs6118603Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0047211 – 153Missing in isoform 1. 1 PublicationAdd BLAST153
Alternative sequenceiVSP_004722154 – 167LAFMT…KIPVR → MNNNWNVCFFLFCP in isoform 1. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_055182535V → VKKASDDLEHENN in isoform 4. Curated1
Alternative sequenceiVSP_0378181154 – 1175AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform 3. CuratedAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L41349 mRNA Translation: AAB02027.1
AL121898 Genomic DNA No translation available.
AL121909 Genomic DNA No translation available.
AL023805 Genomic DNA No translation available.
AL031652 Genomic DNA No translation available.
BC117458 mRNA Translation: AAI17459.1
BC143868 mRNA Translation: AAI43869.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13104.1 [Q15147-4]
CCDS13105.1 [Q15147-1]
CCDS54447.1 [Q15147-5]

NCBI Reference Sequences

More...
RefSeqi
NP_000924.3, NM_000933.3 [Q15147-4]
NP_001166117.1, NM_001172646.1 [Q15147-5]
NP_877949.2, NM_182797.2 [Q15147-1]
XP_016883369.1, XM_017027880.1 [Q15147-4]
XP_016883370.1, XM_017027881.1 [Q15147-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.472101

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000278655; ENSP00000278655; ENSG00000101333 [Q15147-1]
ENST00000378473; ENSP00000367734; ENSG00000101333 [Q15147-5]
ENST00000378493; ENSP00000367754; ENSG00000101333 [Q15147-1]
ENST00000378501; ENSP00000367762; ENSG00000101333 [Q15147-4]
ENST00000414679; ENSP00000390616; ENSG00000101333 [Q15147-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5332

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5332

UCSC genome browser

More...
UCSCi
uc010gbx.4 human [Q15147-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41349 mRNA Translation: AAB02027.1
AL121898 Genomic DNA No translation available.
AL121909 Genomic DNA No translation available.
AL023805 Genomic DNA No translation available.
AL031652 Genomic DNA No translation available.
BC117458 mRNA Translation: AAI17459.1
BC143868 mRNA Translation: AAI43869.1
CCDSiCCDS13104.1 [Q15147-4]
CCDS13105.1 [Q15147-1]
CCDS54447.1 [Q15147-5]
RefSeqiNP_000924.3, NM_000933.3 [Q15147-4]
NP_001166117.1, NM_001172646.1 [Q15147-5]
NP_877949.2, NM_182797.2 [Q15147-1]
XP_016883369.1, XM_017027880.1 [Q15147-4]
XP_016883370.1, XM_017027881.1 [Q15147-1]
UniGeneiHs.472101

3D structure databases

ProteinModelPortaliQ15147
SMRiQ15147
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111348, 3 interactors
DIPiDIP-36735N
IntActiQ15147, 5 interactors
STRINGi9606.ENSP00000334105

PTM databases

iPTMnetiQ15147
PhosphoSitePlusiQ15147
SwissPalmiQ15147

Polymorphism and mutation databases

BioMutaiPLCB4

Proteomic databases

EPDiQ15147
MaxQBiQ15147
PaxDbiQ15147
PeptideAtlasiQ15147
PRIDEiQ15147
ProteomicsDBi60459
60460 [Q15147-2]
60461 [Q15147-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278655; ENSP00000278655; ENSG00000101333 [Q15147-1]
ENST00000378473; ENSP00000367734; ENSG00000101333 [Q15147-5]
ENST00000378493; ENSP00000367754; ENSG00000101333 [Q15147-1]
ENST00000378501; ENSP00000367762; ENSG00000101333 [Q15147-4]
ENST00000414679; ENSP00000390616; ENSG00000101333 [Q15147-5]
GeneIDi5332
KEGGihsa:5332
UCSCiuc010gbx.4 human [Q15147-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5332
DisGeNETi5332
EuPathDBiHostDB:ENSG00000101333.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLCB4
HGNCiHGNC:9059 PLCB4
HPAiHPA007951
MalaCardsiPLCB4
MIMi600810 gene
614669 phenotype
neXtProtiNX_Q15147
OpenTargetsiENSG00000101333
Orphaneti137888 Auriculocondylar syndrome
PharmGKBiPA33387

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00940000156426
HOGENOMiHOG000232046
HOVERGENiHBG053609
InParanoidiQ15147
KOiK05858
OMAiERNIHHN
OrthoDBiEOG091G00XL
PhylomeDBiQ15147
TreeFamiTF352235

Enzyme and pathway databases

BRENDAi3.1.4.11 2681
ReactomeiR-HSA-112043 PLC beta mediated events
R-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol
R-HSA-416476 G alpha (q) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLCB4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLCB4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5332

Protein Ontology

More...
PROi
PR:Q15147

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101333 Expressed in 211 organ(s), highest expression level in parotid gland
ExpressionAtlasiQ15147 baseline and differential
GenevisibleiQ15147 HS

Family and domain databases

CDDicd13361 PH_PLC_beta, 1 hit
Gene3Di2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PIRSFiPIRSF000956 PLC-beta, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCB4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15147
Secondary accession number(s): B7ZLK6
, E2QRH8, Q17R56, Q5JYS8, Q5JYS9, Q5JYT0, Q5JYT3, Q5JYT4, Q9BQW5, Q9BQW6, Q9BQW8, Q9UJQ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: December 5, 2001
Last modified: December 5, 2018
This is version 193 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again