Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 10

Gene

CDK10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells) (PubMed:24218572). Involved in the regulation of actin cytoskeleton organization through the phosphorylation of actin dynamics regulators such as PKN2. Is a negative regulator of ciliogenesis through phosphorylation of PKN2 and promotion of RhoA signaling (PubMed:27104747).2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei68ATPPROSITE-ProRule annotation1
Active sitei163Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi45 – 53ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

  • cell projection organization Source: UniProtKB-KW
  • negative regulation of cell proliferation Source: ProtInc
  • negative regulation of cilium assembly Source: UniProtKB
  • peptidyl-threonine phosphorylation Source: UniProtKB
  • positive regulation of MAPK cascade Source: Ensembl
  • protein phosphorylation Source: GO_Central
  • regulation of actin cytoskeleton organization Source: UniProtKB
  • traversing start control point of mitotic cell cycle Source: ProtInc

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22 2681
SignaLinkiQ15131

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 10 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 10
Serine/threonine-protein kinase PISSLRE
Gene namesi
Name:CDK10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000185324.21
HGNCiHGNC:1770 CDK10
MIMi603464 gene
neXtProtiNX_Q15131

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Al Kaissi syndrome (ALKAS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive developmental disorder characterized by growth retardation, spine malformation, facial dysmorphisms, and developmental delay.
See also OMIM:617694

Organism-specific databases

DisGeNETi8558
MalaCardsiCDK10
MIMi617694 phenotype
OpenTargetsiENSG00000185324
PharmGKBiPA26307

Chemistry databases

ChEMBLiCHEMBL1795191

Polymorphism and mutation databases

BioMutaiCDK10
DMDMi6226784

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000858091 – 360Cyclin-dependent kinase 10Add BLAST360

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei196PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ15131
MaxQBiQ15131
PaxDbiQ15131
PeptideAtlasiQ15131
PRIDEiQ15131
ProteomicsDBi60454
60455 [Q15131-2]
60456 [Q15131-3]
60457 [Q15131-4]

PTM databases

iPTMnetiQ15131
PhosphoSitePlusiQ15131

Expressioni

Gene expression databases

BgeeiENSG00000185324
CleanExiHS_CDK10
ExpressionAtlasiQ15131 baseline and differential
GenevisibleiQ15131 HS

Organism-specific databases

HPAiHPA007451
HPA059634
HPA067060

Interactioni

Subunit structurei

Heterodimer with CCNQ, the interaction is required for kinase activity. Interacts with ETS2. Interacts with PRK2 (PubMed:27104747).2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi114128, 17 interactors
ComplexPortaliCPX-326 Cyclin M-CDK10 complex [Q15131-1]
IntActiQ15131, 16 interactors
STRINGi9606.ENSP00000338673

Structurei

3D structure databases

ProteinModelPortaliQ15131
SMRiQ15131
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini39 – 323Protein kinasePROSITE-ProRule annotationAdd BLAST285

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0663 Eukaryota
ENOG410XQ50 LUCA
GeneTreeiENSGT00910000144030
HOVERGENiHBG014652
InParanoidiQ15131
KOiK02449
OMAiMTDKGCI
OrthoDBiEOG091G048P
PhylomeDBiQ15131
TreeFamiTF101026

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15131-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY
60 70 80 90 100
GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE
110 120 130 140 150
LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG
160 170 180 190 200
LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV
210 220 230 240 250
TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL
260 270 280 290 300
IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL
310 320 330 340 350
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT
360
SEGQSKRCKP
Length:360
Mass (Da):41,038
Last modified:November 1, 1996 - v1
Checksum:i25B28560961103F4
GO
Isoform 2 (identifier: Q15131-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,731
Checksum:i4C1854D5E1858B32
GO
Isoform 3 (identifier: Q15131-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     306-311: Missing.

Show »
Length:283
Mass (Da):31,944
Checksum:iC6B5F44BF84F9B88
GO
Isoform 4 (identifier: Q15131-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

Show »
Length:272
Mass (Da):30,702
Checksum:i6F30BB76F69F772D
GO
Isoform 5 (identifier: Q15131-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW
     195-360: Missing.

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):21,512
Checksum:i05E92EF153FC1303
GO
Isoform 6 (identifier: Q15131-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     141-160: KCIVLQVLRGLQYLHRNFII → RGRGAWGGGMGFMGPCGAHL
     161-360: Missing.

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):17,446
Checksum:iADC10B30602C2148
GO
Isoform 7 (identifier: Q15131-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,662
Checksum:i30C4754ACDF5A8EE
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04198396P → L1 PublicationCorresponds to variant dbSNP:rs55819627Ensembl.1
Natural variantiVAR_041984168N → S1 PublicationCorresponds to variant dbSNP:rs56340740Ensembl.1
Natural variantiVAR_041985342R → H1 PublicationCorresponds to variant dbSNP:rs55757604Ensembl.1
Natural variantiVAR_041986358C → Y1 PublicationCorresponds to variant dbSNP:rs56242003Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0216421 – 71Missing in isoform 2, isoform 3, isoform 4 and isoform 7. 4 PublicationsAdd BLAST71
Alternative sequenceiVSP_05496948 – 54GTYGIVY → D in isoform 5 and isoform 6. 1 Publication7
Alternative sequenceiVSP_054970141 – 160KCIVL…RNFII → RGRGAWGGGMGFMGPCGAHL in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_054971161 – 360Missing in isoform 6. 1 PublicationAdd BLAST200
Alternative sequenceiVSP_054972180 – 194ADFGL…VPVKP → GGCNLGQALSLDGTW in isoform 5 and isoform 7. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_054973195 – 360Missing in isoform 5. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_021643306 – 311Missing in isoform 3. 2 Publications6
Alternative sequenceiVSP_021644329 – 360PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33264 mRNA Translation: AAA60092.2
X78342 mRNA Translation: CAA55137.1
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA Translation: CAB37619.1
AM392903 mRNA Translation: CAL37781.1
AK075036 mRNA Translation: BAG52055.1
AK290485 mRNA Translation: BAF83174.1
AK292351 mRNA Translation: BAF85040.1
AK296631 mRNA Translation: BAH12406.1
AM393177 mRNA Translation: CAL38055.1
AM393204 mRNA Translation: CAL38082.1
AC010538 Genomic DNA No translation available.
CH471184 Genomic DNA Translation: EAW66701.1
CH471184 Genomic DNA Translation: EAW66703.1
CH471184 Genomic DNA Translation: EAW66704.1
CH471184 Genomic DNA Translation: EAW66705.1
CH471184 Genomic DNA Translation: EAW66706.1
CH471184 Genomic DNA Translation: EAW66707.1
CH471184 Genomic DNA Translation: EAW66708.1
CH471184 Genomic DNA Translation: EAW66710.1
BC017342 mRNA Translation: AAH17342.1
BC025301 mRNA Translation: AAH25301.1
CCDSiCCDS10984.2 [Q15131-1]
CCDS32514.2 [Q15131-4]
PIRiS49330
RefSeqiNP_001092003.2, NM_001098533.2 [Q15131-3]
NP_001153839.1, NM_001160367.1 [Q15131-2]
NP_443713.2, NM_052987.3 [Q15131-4]
NP_443714.3, NM_052988.4 [Q15131-1]
XP_016879297.1, XM_017023808.1 [Q15131-2]
XP_016879298.1, XM_017023809.1 [Q15131-3]
XP_016879299.1, XM_017023810.1 [Q15131-4]
UniGeneiHs.699177

Genome annotation databases

EnsembliENST00000353379; ENSP00000338673; ENSG00000185324 [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324 [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324 [Q15131-4]
GeneIDi8558
KEGGihsa:8558
UCSCiuc002fod.4 human [Q15131-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCDK10_HUMAN
AccessioniPrimary (citable) accession number: Q15131
Secondary accession number(s): A8K370
, A8K8I6, A8MXU6, B3KQJ3, B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1996
Last modified: June 20, 2018
This is version 169 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health