Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15131 (CDK10_HUMAN)

Protein

Cyclin-dependent kinase 10

Gene

CDK10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells) (PubMed:24218572). Involved in the regulation of actin cytoskeleton organization through the phosphorylation of actin dynamics regulators such as PKN2. Is a negative regulator of ciliogenesis through phosphorylation of PKN2 and promotion of RhoA signaling (PubMed:27104747).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei68ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei163Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi45 – 53ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • cyclin-dependent protein serine/threonine kinase activity Source: GO_Central
  • protein serine/threonine kinase activity Source: UniProtKB
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.11.22 2681

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q15131

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-dependent kinase 10 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 10
Serine/threonine-protein kinase PISSLRE
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDK10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000185324.21

Human Gene Nomenclature Database

More...HGNCi		HGNC:1770 CDK10

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603464 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15131

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Al Kaissi syndrome (ALKAS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive developmental disorder characterized by growth retardation, spine malformation, facial dysmorphisms, and developmental delay.
See also OMIM:617694

Organism-specific databases

DisGeNET

More...DisGeNETi		8558

MalaCards human disease database

More...MalaCardsi		CDK10
MIMi617694 phenotype

Open Targets

More...OpenTargetsi		ENSG00000185324

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26307

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1795191

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDK10

Domain mapping of disease mutations (DMDM)

More...DMDMi		6226784

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000858091 – 360Cyclin-dependent kinase 10Add BLAST360

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei196PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15131

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15131

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15131

PeptideAtlas

More...PeptideAtlasi		Q15131

PRoteomics IDEntifications database

More...PRIDEi		Q15131

ProteomicsDB human proteome resource

More...ProteomicsDBi		60454
60455 [Q15131-2]
60456 [Q15131-3]
60457 [Q15131-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15131

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15131

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000185324 Expressed in 224 organ(s), highest expression level in pituitary gland

CleanEx database of gene expression profiles

More...CleanExi		HS_CDK10

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15131 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15131 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA007451
HPA059634
HPA067060

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with CCNQ, the interaction is required for kinase activity. Interacts with ETS2. Interacts with PRK2 (PubMed:27104747).2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114128, 18 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-326 Cyclin M-CDK10 complex [Q15131-1]

Protein interaction database and analysis system

More...IntActi		Q15131, 16 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000338673

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q15131

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15131

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 323Protein kinasePROSITE-ProRule annotationAdd BLAST285

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0663 Eukaryota
ENOG410XQ50 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158102

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG014652

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15131

KEGG Orthology (KO)

More...KOi		K02449

Identification of Orthologs from Complete Genome Data

More...OMAi		MTDKGCI

Database of Orthologous Groups

More...OrthoDBi		EOG091G048P

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15131

TreeFam database of animal gene trees

More...TreeFami		TF101026

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15131-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY 
        60         70         80         90        100
GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE 
       110        120        130        140        150
LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG 
       160        170        180        190        200
LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV 
       210        220        230        240        250
TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL 
       260        270        280        290        300
IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL 
       310        320        330        340        350
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT 
       360
SEGQSKRCKP
Length:360
Mass (Da):41,038
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i25B28560961103F4
GO
Isoform 2 (identifier: Q15131-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,731
Checksum:i4C1854D5E1858B32
GO
Isoform 3 (identifier: Q15131-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     306-311: Missing.

Show »
Length:283
Mass (Da):31,944
Checksum:iC6B5F44BF84F9B88
GO
Isoform 4 (identifier: Q15131-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

Show »
Length:272
Mass (Da):30,702
Checksum:i6F30BB76F69F772D
GO
Isoform 5 (identifier: Q15131-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW
     195-360: Missing.

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):21,512
Checksum:i05E92EF153FC1303
GO
Isoform 6 (identifier: Q15131-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     141-160: KCIVLQVLRGLQYLHRNFII → RGRGAWGGGMGFMGPCGAHL
     161-360: Missing.

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):17,446
Checksum:iADC10B30602C2148
GO
Isoform 7 (identifier: Q15131-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,662
Checksum:i30C4754ACDF5A8EE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W872F8W872_HUMAN
Cyclin-dependent kinase 10
CDK10
313Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BT74H3BT74_HUMAN
Cyclin-dependent kinase 10
CDK10
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9UHL7Q9UHL7_HUMAN
Cyclin-dependent kinase 10
CDK10
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHH3D6RHH3_HUMAN
Cyclin-dependent kinase 10
CDK10
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REZ2D6REZ2_HUMAN
Cyclin-dependent kinase 10
CDK10
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RA59D6RA59_HUMAN
Cyclin-dependent kinase 10
CDK10
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSN8H3BSN8_HUMAN
Cyclin-dependent kinase 10
CDK10
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04198396P → L1 PublicationCorresponds to variant dbSNP:rs55819627Ensembl.1
Natural variantiVAR_041984168N → S1 PublicationCorresponds to variant dbSNP:rs56340740Ensembl.1
Natural variantiVAR_041985342R → H1 PublicationCorresponds to variant dbSNP:rs55757604Ensembl.1
Natural variantiVAR_041986358C → Y1 PublicationCorresponds to variant dbSNP:rs56242003Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0216421 – 71Missing in isoform 2, isoform 3, isoform 4 and isoform 7. 4 PublicationsAdd BLAST71
Alternative sequenceiVSP_05496948 – 54GTYGIVY → D in isoform 5 and isoform 6. 1 Publication7
Alternative sequenceiVSP_054970141 – 160KCIVL…RNFII → RGRGAWGGGMGFMGPCGAHL in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_054971161 – 360Missing in isoform 6. 1 PublicationAdd BLAST200
Alternative sequenceiVSP_054972180 – 194ADFGL…VPVKP → GGCNLGQALSLDGTW in isoform 5 and isoform 7. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_054973195 – 360Missing in isoform 5. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_021643306 – 311Missing in isoform 3. 2 Publications6
Alternative sequenceiVSP_021644329 – 360PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L33264 mRNA Translation: AAA60092.2
X78342 mRNA Translation: CAA55137.1
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA Translation: CAB37619.1
AM392903 mRNA Translation: CAL37781.1
AK075036 mRNA Translation: BAG52055.1
AK290485 mRNA Translation: BAF83174.1
AK292351 mRNA Translation: BAF85040.1
AK296631 mRNA Translation: BAH12406.1
AM393177 mRNA Translation: CAL38055.1
AM393204 mRNA Translation: CAL38082.1
AC010538 Genomic DNA No translation available.
CH471184 Genomic DNA Translation: EAW66701.1
CH471184 Genomic DNA Translation: EAW66703.1
CH471184 Genomic DNA Translation: EAW66704.1
CH471184 Genomic DNA Translation: EAW66705.1
CH471184 Genomic DNA Translation: EAW66706.1
CH471184 Genomic DNA Translation: EAW66707.1
CH471184 Genomic DNA Translation: EAW66708.1
CH471184 Genomic DNA Translation: EAW66710.1
BC017342 mRNA Translation: AAH17342.1
BC025301 mRNA Translation: AAH25301.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10984.2 [Q15131-1]
CCDS32514.2 [Q15131-4]

Protein sequence database of the Protein Information Resource

More...PIRi		S49330

NCBI Reference Sequences

More...RefSeqi		NP_001092003.2, NM_001098533.2 [Q15131-3]
NP_001153839.1, NM_001160367.1 [Q15131-2]
NP_443713.2, NM_052987.3 [Q15131-4]
NP_443714.3, NM_052988.4 [Q15131-1]
XP_016879297.1, XM_017023808.1 [Q15131-2]
XP_016879298.1, XM_017023809.1 [Q15131-3]
XP_016879299.1, XM_017023810.1 [Q15131-4]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.699177

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000353379; ENSP00000338673; ENSG00000185324 [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324 [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324 [Q15131-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8558

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8558

UCSC genome browser

More...UCSCi		uc002fod.4 human [Q15131-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33264 mRNA Translation: AAA60092.2
X78342 mRNA Translation: CAA55137.1
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA Translation: CAB37619.1
AM392903 mRNA Translation: CAL37781.1
AK075036 mRNA Translation: BAG52055.1
AK290485 mRNA Translation: BAF83174.1
AK292351 mRNA Translation: BAF85040.1
AK296631 mRNA Translation: BAH12406.1
AM393177 mRNA Translation: CAL38055.1
AM393204 mRNA Translation: CAL38082.1
AC010538 Genomic DNA No translation available.
CH471184 Genomic DNA Translation: EAW66701.1
CH471184 Genomic DNA Translation: EAW66703.1
CH471184 Genomic DNA Translation: EAW66704.1
CH471184 Genomic DNA Translation: EAW66705.1
CH471184 Genomic DNA Translation: EAW66706.1
CH471184 Genomic DNA Translation: EAW66707.1
CH471184 Genomic DNA Translation: EAW66708.1
CH471184 Genomic DNA Translation: EAW66710.1
BC017342 mRNA Translation: AAH17342.1
BC025301 mRNA Translation: AAH25301.1
CCDSiCCDS10984.2 [Q15131-1]
CCDS32514.2 [Q15131-4]
PIRiS49330
RefSeqiNP_001092003.2, NM_001098533.2 [Q15131-3]
NP_001153839.1, NM_001160367.1 [Q15131-2]
NP_443713.2, NM_052987.3 [Q15131-4]
NP_443714.3, NM_052988.4 [Q15131-1]
XP_016879297.1, XM_017023808.1 [Q15131-2]
XP_016879298.1, XM_017023809.1 [Q15131-3]
XP_016879299.1, XM_017023810.1 [Q15131-4]
UniGeneiHs.699177

3D structure databases

ProteinModelPortaliQ15131
SMRiQ15131
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114128, 18 interactors
ComplexPortaliCPX-326 Cyclin M-CDK10 complex [Q15131-1]
IntActiQ15131, 16 interactors
STRINGi9606.ENSP00000338673

Chemistry databases

ChEMBLiCHEMBL1795191

PTM databases

iPTMnetiQ15131
PhosphoSitePlusiQ15131

Polymorphism and mutation databases

BioMutaiCDK10
DMDMi6226784

Proteomic databases

EPDiQ15131
MaxQBiQ15131
PaxDbiQ15131
PeptideAtlasiQ15131
PRIDEiQ15131
ProteomicsDBi60454
60455 [Q15131-2]
60456 [Q15131-3]
60457 [Q15131-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		8558
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000353379; ENSP00000338673; ENSG00000185324 [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324 [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324 [Q15131-4]
GeneIDi8558
KEGGihsa:8558
UCSCiuc002fod.4 human [Q15131-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8558
DisGeNETi8558
EuPathDBiHostDB:ENSG00000185324.21

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDK10
HGNCiHGNC:1770 CDK10
HPAiHPA007451
HPA059634
HPA067060
MalaCardsiCDK10
MIMi603464 gene
617694 phenotype
neXtProtiNX_Q15131
OpenTargetsiENSG00000185324
PharmGKBiPA26307

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0663 Eukaryota
ENOG410XQ50 LUCA
GeneTreeiENSGT00940000158102
HOVERGENiHBG014652
InParanoidiQ15131
KOiK02449
OMAiMTDKGCI
OrthoDBiEOG091G048P
PhylomeDBiQ15131
TreeFamiTF101026

Enzyme and pathway databases

BRENDAi2.7.11.22 2681
SignaLinkiQ15131

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CDK10 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Cyclin-dependent_kinase_10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8558

Protein Ontology

More...PROi		PR:Q15131

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000185324 Expressed in 224 organ(s), highest expression level in pituitary gland
CleanExiHS_CDK10
ExpressionAtlasiQ15131 baseline and differential
GenevisibleiQ15131 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDK10_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15131
Secondary accession number(s): A8K370
, A8K8I6, A8MXU6, B3KQJ3, B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again