Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (13 Feb 2019)
Sequence version 2 (07 Mar 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Periostin

Gene

POSTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Induces cell attachment and spreading and plays a role in cell adhesion (PubMed:12235007). Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHeparin-binding
Biological processCell adhesion

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q15063

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Periostin
Short name:
PN
Alternative name(s):
Osteoblast-specific factor 2
Short name:
OSF-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:POSTN
Synonyms:OSF2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000133110.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16953 POSTN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608777 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15063

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Golgi apparatus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10631

Open Targets

More...
OpenTargetsi
ENSG00000133110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134900304

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
POSTN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
93138709

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000878922 – 836PeriostinAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi44 ↔ 80PROSITE-ProRule annotation
Disulfide bondi60 ↔ 69PROSITE-ProRule annotation
Disulfide bondi79 ↔ 92PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi599N-linked (GlcNAc...) asparagine2 Publications1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Gamma-carboxylation is controversial. Gamma-carboxyglutamated; gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation; this may be required for calcium binding (PubMed:18450759). According to a more recent report, does not contain vitamin K-dependent gamma-carboxyglutamate residues (PubMed:26273833).2 Publications

Keywords - PTMi

Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15063

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15063

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15063

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15063

PeptideAtlas

More...
PeptideAtlasi
Q15063

PRoteomics IDEntifications database

More...
PRIDEi
Q15063

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60417
60418 [Q15063-2]
60419 [Q15063-3]
60420 [Q15063-4]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1599

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15063

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15063

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133110 Expressed in 203 organ(s), highest expression level in periodontal ligament

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15063 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15063 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA012306

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BMP1 and fibronectin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115875, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q15063, 3 interactors

Molecular INTeraction database

More...
MINTi
Q15063

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369071

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1836
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WT7NMR-A496-632[»]
5YJGX-ray2.40A22-631[»]
5YJHX-ray2.96A17-631[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q15063

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15063

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 94EMIPROSITE-ProRule annotationAdd BLAST55
Domaini97 – 230FAS1 1PROSITE-ProRule annotationCuratedAdd BLAST134
Domaini234 – 365FAS1 2PROSITE-ProRule annotationCuratedAdd BLAST132
Domaini368 – 492FAS1 3PROSITE-ProRule annotationCuratedAdd BLAST125
Domaini496 – 628FAS1 4PROSITE-ProRule annotationCuratedAdd BLAST133

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1437 Eukaryota
COG2335 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063860

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220865

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000715

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15063

Identification of Orthologs from Complete Genome Data

More...
OMAi
ANGHYDK

Database of Orthologous Groups

More...
OrthoDBi
1437416at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15063

TreeFam database of animal gene trees

More...
TreeFami
TF316269

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.180.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011489 EMI_domain
IPR036378 FAS1_dom_sf
IPR000782 FAS1_domain
IPR016666 TGFBI/POSTN

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02469 Fasciclin, 4 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF016553 BIGH3_OSF2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00554 FAS1, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF82153 SSF82153, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51041 EMI, 1 hit
PS50213 FAS1, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q15063-1) [UniParc]FASTAAdd to basket
Also known as: OSF-2OS1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL
60 70 80 90 100
GTKKKYFSTC KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH
110 120 130 140 150
VYGTLGIVGA TTTQRYSDAS KLREEIEGKG SFTYFAPSNE AWDNLDSDIR
160 170 180 190 200
RGLESNVNVE LLNALHSHMI NKRMLTKDLK NGMIIPSMYN NLGLFINHYP
210 220 230 240 250
NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF IEAEDDLSSF
260 270 280 290 300
RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL
310 320 330 340 350
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD
360 370 380 390 400
IVTNNGVIHL IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD
410 420 430 440 450
GEYTLLAPVN NAFSDDTLSM DQRLLKLILQ NHILKVKVGL NELYNGQILE
460 470 480 490 500
TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG RNGAIHIFRE IIKPAEKSLH
510 520 530 540 550
EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA FKGMTSEEKE
560 570 580 590 600
ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND
610 620 630 640 650
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY
660 670 680 690 700
IQIKFVRGST FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL
710 720 730 740 750
TKVKIEGEPE FRLIKEGETI TEVIHGEPII KKYTKIIDGV PVEITEKETR
760 770 780 790 800
EERIITGPEI KYTRISTGGG ETEETLKKLL QEEVTKVTKF IEGGDGHLFE
810 820 830
DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ
Length:836
Mass (Da):93,314
Last modified:March 7, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i55E7B82D094824FD
GO
Isoform 21 Publication (identifier: Q15063-2) [UniParc]FASTAAdd to basket
Also known as: OSF-2p1

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K

Show »
Length:779
Mass (Da):87,021
Checksum:iC6936F32A42B8366
GO
Isoform 31 Publication (identifier: Q15063-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
     783-810: Missing.

Show »
Length:781
Mass (Da):87,254
Checksum:iD082BC8F86ABAC37
GO
Isoform 4 (identifier: Q15063-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
     783-810: Missing.

Show »
Length:751
Mass (Da):83,850
Checksum:i7241170E4CDC18D3
GO
Isoform 5 (identifier: Q15063-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R

Show »
Length:809
Mass (Da):90,424
Checksum:i43DECD94CB76B07A
GO
Isoform 6 (identifier: Q15063-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S

Show »
Length:749
Mass (Da):83,527
Checksum:i13F23F62B1C1AAE9
GO
Isoform 7 (identifier: Q15063-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S
     783-810: Missing.

Show »
Length:721
Mass (Da):80,357
Checksum:iCE5CEFA7E156957B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1ALD9B1ALD9_HUMAN
Periostin
POSTN
808Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti290I → F in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti290I → F in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti290I → F in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti290I → F in AAY15840 (Ref. 4) Curated1
Sequence conflicti421D → V in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti421D → V in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti421D → V in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti421D → V in AAY15840 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049115339T → I. Corresponds to variant dbSNP:rs9594223Ensembl.1
Natural variantiVAR_049116814V → M. Corresponds to variant dbSNP:rs9547952Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055183670 – 757TTKII…RIITG → S in isoform 6 and isoform 7. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_050005670 – 727TTKII…VIHGE → K in isoform 2 and isoform 4. 3 PublicationsAdd BLAST58
Alternative sequenceiVSP_050669670 – 697TTKII…IKTEG → R in isoform 3 and isoform 5. 3 PublicationsAdd BLAST28
Alternative sequenceiVSP_050670783 – 810Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D13665 mRNA Translation: BAA02836.1
D13666 mRNA Translation: BAA02837.1
AY140646 mRNA Translation: AAN17733.1
EU262883 mRNA Translation: ABY86630.1
EU262884 mRNA Translation: ABY86631.1
EU262886 mRNA Translation: ABY86633.1
AY918092 mRNA Translation: AAY15840.1
AL138679 Genomic DNA No translation available.
AL646087 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08590.1
BC106709 mRNA Translation: AAI06710.1
BC106710 mRNA Translation: AAI06711.1
GU354210 mRNA Translation: ADA79517.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45034.1 [Q15063-2]
CCDS53864.1 [Q15063-3]
CCDS66530.1 [Q15063-6]
CCDS66531.1 [Q15063-5]
CCDS9364.1 [Q15063-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S36110
S36111

NCBI Reference Sequences

More...
RefSeqi
NP_001129406.1, NM_001135934.1 [Q15063-2]
NP_001129407.1, NM_001135935.1 [Q15063-3]
NP_001129408.1, NM_001135936.1 [Q15063-4]
NP_001273594.1, NM_001286665.1 [Q15063-5]
NP_001273595.1, NM_001286666.1 [Q15063-6]
NP_001273596.1, NM_001286667.1 [Q15063-7]
NP_001317446.1, NM_001330517.1
NP_006466.2, NM_006475.2 [Q15063-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.136348
Hs.721018

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000379742; ENSP00000369066; ENSG00000133110 [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110 [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110 [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110 [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110 [Q15063-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10631

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10631

UCSC genome browser

More...
UCSCi
uc001uwo.5 human [Q15063-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA Translation: BAA02836.1
D13666 mRNA Translation: BAA02837.1
AY140646 mRNA Translation: AAN17733.1
EU262883 mRNA Translation: ABY86630.1
EU262884 mRNA Translation: ABY86631.1
EU262886 mRNA Translation: ABY86633.1
AY918092 mRNA Translation: AAY15840.1
AL138679 Genomic DNA No translation available.
AL646087 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08590.1
BC106709 mRNA Translation: AAI06710.1
BC106710 mRNA Translation: AAI06711.1
GU354210 mRNA Translation: ADA79517.1
CCDSiCCDS45034.1 [Q15063-2]
CCDS53864.1 [Q15063-3]
CCDS66530.1 [Q15063-6]
CCDS66531.1 [Q15063-5]
CCDS9364.1 [Q15063-1]
PIRiS36110
S36111
RefSeqiNP_001129406.1, NM_001135934.1 [Q15063-2]
NP_001129407.1, NM_001135935.1 [Q15063-3]
NP_001129408.1, NM_001135936.1 [Q15063-4]
NP_001273594.1, NM_001286665.1 [Q15063-5]
NP_001273595.1, NM_001286666.1 [Q15063-6]
NP_001273596.1, NM_001286667.1 [Q15063-7]
NP_001317446.1, NM_001330517.1
NP_006466.2, NM_006475.2 [Q15063-1]
UniGeneiHs.136348
Hs.721018

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WT7NMR-A496-632[»]
5YJGX-ray2.40A22-631[»]
5YJHX-ray2.96A17-631[»]
ProteinModelPortaliQ15063
SMRiQ15063
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115875, 5 interactors
IntActiQ15063, 3 interactors
MINTiQ15063
STRINGi9606.ENSP00000369071

PTM databases

GlyConnecti1599
iPTMnetiQ15063
PhosphoSitePlusiQ15063

Polymorphism and mutation databases

BioMutaiPOSTN
DMDMi93138709

Proteomic databases

EPDiQ15063
jPOSTiQ15063
MaxQBiQ15063
PaxDbiQ15063
PeptideAtlasiQ15063
PRIDEiQ15063
ProteomicsDBi60417
60418 [Q15063-2]
60419 [Q15063-3]
60420 [Q15063-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379742; ENSP00000369066; ENSG00000133110 [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110 [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110 [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110 [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110 [Q15063-6]
GeneIDi10631
KEGGihsa:10631
UCSCiuc001uwo.5 human [Q15063-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10631
DisGeNETi10631
EuPathDBiHostDB:ENSG00000133110.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
POSTN
HGNCiHGNC:16953 POSTN
HPAiHPA012306
MIMi608777 gene
neXtProtiNX_Q15063
OpenTargetsiENSG00000133110
PharmGKBiPA134900304

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1437 Eukaryota
COG2335 LUCA
GeneTreeiENSGT00530000063860
HOGENOMiHOG000220865
HOVERGENiHBG000715
InParanoidiQ15063
OMAiANGHYDK
OrthoDBi1437416at2759
PhylomeDBiQ15063
TreeFamiTF316269

Enzyme and pathway databases

SIGNORiQ15063

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
POSTN human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Periostin
POSTN

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10631

Protein Ontology

More...
PROi
PR:Q15063

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000133110 Expressed in 203 organ(s), highest expression level in periodontal ligament
ExpressionAtlasiQ15063 baseline and differential
GenevisibleiQ15063 HS

Family and domain databases

Gene3Di2.30.180.10, 4 hits
InterProiView protein in InterPro
IPR011489 EMI_domain
IPR036378 FAS1_dom_sf
IPR000782 FAS1_domain
IPR016666 TGFBI/POSTN
PfamiView protein in Pfam
PF02469 Fasciclin, 4 hits
PIRSFiPIRSF016553 BIGH3_OSF2, 1 hit
SMARTiView protein in SMART
SM00554 FAS1, 4 hits
SUPFAMiSSF82153 SSF82153, 4 hits
PROSITEiView protein in PROSITE
PS51041 EMI, 1 hit
PS50213 FAS1, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPOSTN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15063
Secondary accession number(s): B1ALD8
, C0IMJ1, C0IMJ2, C0IMJ4, D2KRH7, F5H628, Q15064, Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: March 7, 2006
Last modified: February 13, 2019
This is version 168 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again