Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysine--tRNA ligase

Gene

KARS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (PubMed:9278442, PubMed:18029264, PubMed:18272479). When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages (PubMed:15851690). Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity (PubMed:5338216, PubMed:14975237, PubMed:19524539, PubMed:23159739).7 Publications
(Microbial infection) Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA3(Lys), the primer for reverse transcription initiation.1 Publication

Miscellaneous

Shares a bidirectional promoter with TERF2IP/RAP1.1 Publication

Catalytic activityi

ATP + L-lysine + tRNA(Lys) = AMP + diphosphate + L-lysyl-tRNA(Lys).3 Publications

Activity regulationi

Up-regulated by DARS and EEF1A1, but not by AIMP2.1 Publication

Kineticsi

Kcat is 0.31 (sec-1) for aminoacylation for tRNA(Lys).1 Publication
  1. KM=1.19 µM for tRNA(Lys)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Binding sitei277Substrate; via carbonyl oxygen2 Publications1
    Binding sitei301Substrate3 Publications1
    Binding sitei339Substrate3 Publications1
    Binding sitei341Substrate3 Publications1
    Binding sitei497Substrate3 Publications1
    Binding sitei501Substrate3 Publications1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Nucleotide bindingi323 – 325ATP1 Publication3
    Nucleotide bindingi331 – 332ATP1 Publication2
    Nucleotide bindingi494 – 495ATP1 Publication2
    Nucleotide bindingi550 – 553ATP1 Publication4

    GO - Molecular functioni

    • amino acid binding Source: Ensembl
    • ATP adenylyltransferase activity Source: UniProtKB
    • ATP binding Source: UniProtKB-KW
    • identical protein binding Source: IntAct
    • lysine-tRNA ligase activity Source: UniProtKB
    • protein homodimerization activity Source: UniProtKB
    • tRNA binding Source: UniProtKB

    GO - Biological processi

    Keywordsi

    Molecular functionAminoacyl-tRNA synthetase, Ligase, Transferase
    Biological processHost-virus interaction, Protein biosynthesis
    LigandATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi6.1.1.6 2681
    ReactomeiR-HSA-2408517 SeMet incorporation into proteins
    R-HSA-379716 Cytosolic tRNA aminoacylation
    R-HSA-379726 Mitochondrial tRNA aminoacylation
    SIGNORiQ15046

    Protein family/group databases

    MoonProtiQ15046

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Lysine--tRNA ligase (EC:2.7.7.-3 Publications, EC:6.1.1.63 Publications)
    Alternative name(s):
    Lysyl-tRNA synthetase
    Short name:
    LysRS
    Gene namesi
    Name:KARS
    Synonyms:KIAA0070
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 16

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000065427.14
    HGNCiHGNC:6215 KARS
    MIMi601421 gene
    neXtProtiNX_Q15046

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane, Mitochondrion, Nucleus, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Charcot-Marie-Tooth disease, recessive, intermediate type, B (CMTRIB)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Recessive intermediate forms of Charcot-Marie-Tooth disease are characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
    See also OMIM:613641
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_064911105L → H in CMTRIB; severely affects enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607194Ensembl.1
    Natural variantiVAR_064912274I → M in CMTRIB. 1 PublicationCorresponds to variant dbSNP:rs146955132Ensembl.1
    Deafness, autosomal recessive, 89 (DFNB89)2 Publications
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA form of non-syndromic deafness characterized by bilateral, prelingual, moderate to severe hearing loss affecting all frequencies.
    See also OMIM:613916
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_070233145Y → H in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514745Ensembl.1
    Natural variantiVAR_070234349D → N in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514746Ensembl.1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi1 – 65Missing : Loss of nuclear localization, but no effect on packaging into HIV-1. 1 PublicationAdd BLAST65
    Mutagenesisi101V → D, R or W: Disrupts interaction with AIMP2 and the multisynthase complex. 1 Publication1
    Mutagenesisi207S → A: Strongly reduced production of diadenosine tetraphosphate (Ap4A). Reduced protein phosphorylation. 1 Publication1
    Mutagenesisi207S → D: Phosphomimetic mutant that strongly enhances translocation into the nucleus and production of diadenosine tetraphosphate (Ap4A). Almost complete loss of tRNA ligase activity. 1 Publication1
    Mutagenesisi207S → R: Strongly decreased tRNA ligase activity. 1 Publication1
    Mutagenesisi207S → Y: Almost complete loss of tRNA ligase activity. 1 Publication1
    Mutagenesisi346D → R: Induces protein aggregation. Releases from the subunit complex. 1 Publication1
    Mutagenesisi540G → Y: Disrupts interaction with AIMP2 and the multisynthase complex. Increases production of diadenosine tetraphosphate (Ap4A). Almost complete loss of tRNA ligase activity. 1 Publication1

    Keywords - Diseasei

    Charcot-Marie-Tooth disease, Deafness, Disease mutation, Neurodegeneration, Neuropathy, Non-syndromic deafness

    Organism-specific databases

    DisGeNETi3735
    MalaCardsiKARS
    MIMi613641 phenotype
    613916 phenotype
    OpenTargetsiENSG00000065427
    Orphaneti254334 Autosomal recessive intermediate Charcot-Marie-Tooth disease type B
    90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
    PharmGKBiPA30016

    Chemistry databases

    ChEMBLiCHEMBL5575
    DrugBankiDB00123 L-Lysine

    Polymorphism and mutation databases

    BioMutaiKARS
    DMDMi20178333

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Initiator methionineiRemovedCombined sources1 Publication
    ChainiPRO_00001527652 – 597Lysine--tRNA ligaseAdd BLAST596

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei2N-acetylalanineCombined sources1 Publication1
    Modified residuei88N6-acetyllysineCombined sources1
    Modified residuei141N6-acetyllysineCombined sources1
    Modified residuei207Phosphoserine1 Publication1
    Modified residuei590PhosphoserineBy similarity1
    Modified residuei591PhosphothreonineBy similarity1
    Modified residuei596PhosphoserineBy similarity1

    Post-translational modificationi

    Phosphorylated on a serine residue after mast cell stimulation with immunoglobulin E (IgE).By similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    EPDiQ15046
    MaxQBiQ15046
    PaxDbiQ15046
    PeptideAtlasiQ15046
    PRIDEiQ15046
    ProteomicsDBi60395
    60396 [Q15046-2]

    PTM databases

    CarbonylDBiQ15046
    iPTMnetiQ15046
    PhosphoSitePlusiQ15046
    SwissPalmiQ15046

    Expressioni

    Gene expression databases

    BgeeiENSG00000065427 Expressed in 238 organ(s), highest expression level in thoracic mammary gland
    CleanExiHS_KARS
    ExpressionAtlasiQ15046 baseline and differential
    GenevisibleiQ15046 HS

    Organism-specific databases

    HPAiHPA041345
    HPA041550

    Interactioni

    Subunit structurei

    Homodimer and tetradimer (PubMed:18272479, PubMed:23159739, PubMed:26074468, PubMed:28887846). Part of the multisynthetase complex (MSC), a multisubunit complex that groups tRNA ligases for Arg (RARS), Asp (DARS), Gln (QARS), Ile (IARS), Leu (LARS), Lys (KARS), Met (MARS) the bifunctional ligase for Glu and Pro (EPRS) and the auxiliary subunits AIMP1/p43, AIMP2/p38 and EEF1E1/p18 (PubMed:19131329, PubMed:19289464, PubMed:24312579, PubMed:23159739). Interacts with AIMP2 (via N-terminus) and MITF (PubMed:9878398, PubMed:14975237, PubMed:15220430, PubMed:23159739, PubMed:26074468). Interacts with TARSL2 (PubMed:24312579).11 Publications
    (Microbial infection) Interacts directly with HIV-1 virus GAG protein (PubMed:12756246, PubMed:15220430).2 Publications

    Binary interactionsi

    GO - Molecular functioni

    Protein-protein interaction databases

    BioGridi109938, 155 interactors
    CORUMiQ15046
    DIPiDIP-29725N
    IntActiQ15046, 42 interactors
    MINTiQ15046
    STRINGi9606.ENSP00000325448

    Chemistry databases

    BindingDBiQ15046

    Structurei

    Secondary structure

    1597
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    ProteinModelPortaliQ15046
    SMRiQ15046
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ15046

    Family & Domainsi

    Domaini

    The N-terminal domain (1-65) of the cytoplasmic isoform is a functional tRNA-binding domain, is required for nuclear localization, is involved in the interaction with DARS, but has a repulsive role in the binding to EEF1A1. A central domain (208-259) is involved in homodimerization and is required for interaction with HIV-1 GAG and incorporation into virions. The C-terminal domain (452-597) is not required for interaction with AIMP2.2 Publications

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiKOG1885 Eukaryota
    COG1190 LUCA
    GeneTreeiENSGT00550000074841
    HOGENOMiHOG000236577
    HOVERGENiHBG002562
    InParanoidiQ15046
    KOiK04567
    OMAiEIFGEKC
    OrthoDBiEOG091G03SI
    PhylomeDBiQ15046
    TreeFamiTF300365

    Family and domain databases

    CDDicd00775 LysRS_core, 1 hit
    HAMAPiMF_00252 Lys_tRNA_synth_class2, 1 hit
    InterProiView protein in InterPro
    IPR004364 aa-tRNA-synt_II
    IPR006195 aa-tRNA-synth_II
    IPR002313 Lys-tRNA-ligase_II
    IPR034762 Lys-tRNA-ligase_II_bac/euk
    IPR018149 Lys-tRNA-synth_II_C
    IPR012340 NA-bd_OB-fold
    IPR004365 NA-bd_OB_tRNA
    PfamiView protein in Pfam
    PF00152 tRNA-synt_2, 1 hit
    PF01336 tRNA_anti-codon, 1 hit
    PIRSFiPIRSF039101 LysRS2, 1 hit
    PRINTSiPR00982 TRNASYNTHLYS
    SUPFAMiSSF50249 SSF50249, 1 hit
    TIGRFAMsiTIGR00499 lysS_bact, 1 hit
    PROSITEiView protein in PROSITE
    PS50862 AA_TRNA_LIGASE_II, 1 hit

    Sequences (2+)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

    Isoform Cytoplasmic (identifier: Q15046-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MAAVQAAEVK VDGSEPKLSK NELKRRLKAE KKVAEKEAKQ KELSEKQLSQ
    60 70 80 90 100
    ATAAATNHTT DNGVGPEEES VDPNQYYKIR SQAIHQLKVN GEDPYPHKFH
    110 120 130 140 150
    VDISLTDFIQ KYSHLQPGDH LTDITLKVAG RIHAKRASGG KLIFYDLRGE
    160 170 180 190 200
    GVKLQVMANS RNYKSEEEFI HINNKLRRGD IIGVQGNPGK TKKGELSIIP
    210 220 230 240 250
    YEITLLSPCL HMLPHLHFGL KDKETRYRQR YLDLILNDFV RQKFIIRSKI
    260 270 280 290 300
    ITYIRSFLDE LGFLEIETPM MNIIPGGAVA KPFITYHNEL DMNLYMRIAP
    310 320 330 340 350
    ELYHKMLVVG GIDRVYEIGR QFRNEGIDLT HNPEFTTCEF YMAYADYHDL
    360 370 380 390 400
    MEITEKMVSG MVKHITGSYK VTYHPDGPEG QAYDVDFTPP FRRINMVEEL
    410 420 430 440 450
    EKALGMKLPE TNLFETEETR KILDDICVAK AVECPPPRTT ARLLDKLVGE
    460 470 480 490 500
    FLEVTCINPT FICDHPQIMS PLAKWHRSKE GLTERFELFV MKKEICNAYT
    510 520 530 540 550
    ELNDPMRQRQ LFEEQAKAKA AGDDEAMFID ENFCTALEYG LPPTAGWGMG
    560 570 580 590
    IDRVAMFLTD SNNIKEVLLF PAMKPEDKKE NVATTDTLES TTVGTSV
    Length:597
    Mass (Da):68,048
    Last modified:April 16, 2002 - v3
    Checksum:iE7770953332D905D
    GO
    Isoform Mitochondrial (identifier: Q15046-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-21: MAAVQAAEVKVDGSEPKLSKN → MLTQAAVRLVRGSLRKTSWAEWGHRELRLGQLAPFTAPHKDKSFSDQRS

    Note: Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 1-16.Curated
    Show »
    Length:625
    Mass (Da):71,497
    Checksum:i294DA1CE5A137AD6
    GO

    Computationally mapped potential isoform sequencesi

    There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H3BPV7H3BPV7_HUMAN
    Lysine--tRNA ligase
    KARS
    104Annotation score:
    H3BVA8H3BVA8_HUMAN
    Lysine--tRNA ligase
    KARS
    256Annotation score:
    H3BQK5H3BQK5_HUMAN
    Lysine--tRNA ligase
    KARS
    124Annotation score:
    H3BRC9H3BRC9_HUMAN
    Lysine--tRNA ligase
    KARS
    76Annotation score:
    H3BSN6H3BSN6_HUMAN
    Lysine--tRNA ligase
    KARS
    86Annotation score:
    J3KRL2J3KRL2_HUMAN
    Lysine--tRNA ligase
    KARS
    102Annotation score:
    H3BMR9H3BMR9_HUMAN
    Lysine--tRNA ligase
    KARS
    67Annotation score:

    Sequence cautioni

    The sequence BAA06688 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Isoform Mitochondrial (identifier: Q15046-2)
    Sequence conflicti48R → G in AAG30114 (PubMed:10952987).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_064911105L → H in CMTRIB; severely affects enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607194Ensembl.1
    Natural variantiVAR_070233145Y → H in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514745Ensembl.1
    Natural variantiVAR_052640179G → A. Corresponds to variant dbSNP:rs11557665Ensembl.1
    Natural variantiVAR_064912274I → M in CMTRIB. 1 PublicationCorresponds to variant dbSNP:rs146955132Ensembl.1
    Natural variantiVAR_070234349D → N in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514746Ensembl.1
    Natural variantiVAR_079741350L → H Found in a patient with hypertrophic cardiomyopathy and mild intellectual disability together with proximal muscle weakness; unknown pathological significance. 1 Publication1
    Natural variantiVAR_079742390P → R Found in a patient with hypertrophic cardiomyopathy and mild intellectual disability together with proximal muscle weakness; unknown pathological significance. 1 Publication1
    Natural variantiVAR_079743438R → W Found in patients with severe infantile visual loss with progressive microcephaly and developmental delay as well as seizures and abnormal subcortical white matter; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs761527468Ensembl.1
    Natural variantiVAR_079744477R → H Probable disease-associated mutation found in a family with sensorineural hearing loss and leukoencephalopathy; decreases tRNA-lysine aminoacylation; induces protein aggregation; releases from the subunit complex; no effect on cytoplasmic location; no effect on oligomerization. 1 PublicationCorresponds to variant dbSNP:rs778748895EnsemblClinVar.1
    Natural variantiVAR_079745505P → S Probable disease-associated mutation found in a family with sensorineural hearing loss and leukoencephalopathy; decreases tRNA-lysine aminoacylation; slightly induces protein aggregation; no effect on cytoplasmic location; no effect on oligomerization. 1 Publication1
    Natural variantiVAR_079746525E → K Found in patients with severe infantile visual loss with progressive microcephaly and developmental delay as well as seizures and abnormal subcortical white matter; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs770522582Ensembl.1
    Natural variantiVAR_016105595T → S3 PublicationsCorresponds to variant dbSNP:rs6834Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0384811 – 21MAAVQ…KLSKN → MLTQAAVRLVRGSLRKTSWA EWGHRELRLGQLAPFTAPHK DKSFSDQRS in isoform Mitochondrial. 1 PublicationAdd BLAST21

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    D32053 mRNA Translation: BAA22084.1
    AF285758 mRNA Translation: AAG30114.1
    D31890 mRNA Translation: BAA06688.1 Different initiation.
    AC025287 Genomic DNA No translation available.
    CH471114 Genomic DNA Translation: EAW95622.1
    CH471114 Genomic DNA Translation: EAW95624.1
    BC004132 mRNA Translation: AAH04132.1
    CCDSiCCDS10923.1 [Q15046-1]
    CCDS45532.1 [Q15046-2]
    RefSeqiNP_001123561.1, NM_001130089.1 [Q15046-2]
    NP_005539.1, NM_005548.2 [Q15046-1]
    UniGeneiHs.3100

    Genome annotation databases

    EnsembliENST00000302445; ENSP00000303043; ENSG00000065427 [Q15046-1]
    ENST00000319410; ENSP00000325448; ENSG00000065427 [Q15046-2]
    GeneIDi3735
    KEGGihsa:3735
    UCSCiuc002feq.4 human [Q15046-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    D32053 mRNA Translation: BAA22084.1
    AF285758 mRNA Translation: AAG30114.1
    D31890 mRNA Translation: BAA06688.1 Different initiation.
    AC025287 Genomic DNA No translation available.
    CH471114 Genomic DNA Translation: EAW95622.1
    CH471114 Genomic DNA Translation: EAW95624.1
    BC004132 mRNA Translation: AAH04132.1
    CCDSiCCDS10923.1 [Q15046-1]
    CCDS45532.1 [Q15046-2]
    RefSeqiNP_001123561.1, NM_001130089.1 [Q15046-2]
    NP_005539.1, NM_005548.2 [Q15046-1]
    UniGeneiHs.3100

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3BJUX-ray2.31A/B/C/D70-582[»]
    4DPGX-ray2.84A/B/C/D/E/F/G/H70-581[»]
    4YCUX-ray2.10A/B70-581[»]
    4YCWX-ray2.90A/B/E/F70-581[»]
    6CHDX-ray2.50A/B1-597[»]
    ProteinModelPortaliQ15046
    SMRiQ15046
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi109938, 155 interactors
    CORUMiQ15046
    DIPiDIP-29725N
    IntActiQ15046, 42 interactors
    MINTiQ15046
    STRINGi9606.ENSP00000325448

    Chemistry databases

    BindingDBiQ15046
    ChEMBLiCHEMBL5575
    DrugBankiDB00123 L-Lysine

    Protein family/group databases

    MoonProtiQ15046

    PTM databases

    CarbonylDBiQ15046
    iPTMnetiQ15046
    PhosphoSitePlusiQ15046
    SwissPalmiQ15046

    Polymorphism and mutation databases

    BioMutaiKARS
    DMDMi20178333

    Proteomic databases

    EPDiQ15046
    MaxQBiQ15046
    PaxDbiQ15046
    PeptideAtlasiQ15046
    PRIDEiQ15046
    ProteomicsDBi60395
    60396 [Q15046-2]

    Protocols and materials databases

    DNASUi3735
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000302445; ENSP00000303043; ENSG00000065427 [Q15046-1]
    ENST00000319410; ENSP00000325448; ENSG00000065427 [Q15046-2]
    GeneIDi3735
    KEGGihsa:3735
    UCSCiuc002feq.4 human [Q15046-1]

    Organism-specific databases

    CTDi3735
    DisGeNETi3735
    EuPathDBiHostDB:ENSG00000065427.14
    GeneCardsiKARS
    HGNCiHGNC:6215 KARS
    HPAiHPA041345
    HPA041550
    MalaCardsiKARS
    MIMi601421 gene
    613641 phenotype
    613916 phenotype
    neXtProtiNX_Q15046
    OpenTargetsiENSG00000065427
    Orphaneti254334 Autosomal recessive intermediate Charcot-Marie-Tooth disease type B
    90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
    PharmGKBiPA30016
    HUGEiSearch...
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG1885 Eukaryota
    COG1190 LUCA
    GeneTreeiENSGT00550000074841
    HOGENOMiHOG000236577
    HOVERGENiHBG002562
    InParanoidiQ15046
    KOiK04567
    OMAiEIFGEKC
    OrthoDBiEOG091G03SI
    PhylomeDBiQ15046
    TreeFamiTF300365

    Enzyme and pathway databases

    BRENDAi6.1.1.6 2681
    ReactomeiR-HSA-2408517 SeMet incorporation into proteins
    R-HSA-379716 Cytosolic tRNA aminoacylation
    R-HSA-379726 Mitochondrial tRNA aminoacylation
    SIGNORiQ15046

    Miscellaneous databases

    ChiTaRSiKARS human
    EvolutionaryTraceiQ15046
    GeneWikiiKARS_(gene)
    GenomeRNAii3735
    PROiPR:Q15046
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000065427 Expressed in 238 organ(s), highest expression level in thoracic mammary gland
    CleanExiHS_KARS
    ExpressionAtlasiQ15046 baseline and differential
    GenevisibleiQ15046 HS

    Family and domain databases

    CDDicd00775 LysRS_core, 1 hit
    HAMAPiMF_00252 Lys_tRNA_synth_class2, 1 hit
    InterProiView protein in InterPro
    IPR004364 aa-tRNA-synt_II
    IPR006195 aa-tRNA-synth_II
    IPR002313 Lys-tRNA-ligase_II
    IPR034762 Lys-tRNA-ligase_II_bac/euk
    IPR018149 Lys-tRNA-synth_II_C
    IPR012340 NA-bd_OB-fold
    IPR004365 NA-bd_OB_tRNA
    PfamiView protein in Pfam
    PF00152 tRNA-synt_2, 1 hit
    PF01336 tRNA_anti-codon, 1 hit
    PIRSFiPIRSF039101 LysRS2, 1 hit
    PRINTSiPR00982 TRNASYNTHLYS
    SUPFAMiSSF50249 SSF50249, 1 hit
    TIGRFAMsiTIGR00499 lysS_bact, 1 hit
    PROSITEiView protein in PROSITE
    PS50862 AA_TRNA_LIGASE_II, 1 hit
    ProtoNetiSearch...

    Entry informationi

    Entry nameiSYK_HUMAN
    AccessioniPrimary (citable) accession number: Q15046
    Secondary accession number(s): A8MSK1
    , D3DUK4, O14946, Q96J25, Q9HB23
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: April 16, 2002
    Last modified: November 7, 2018
    This is version 179 of the entry and version 3 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. Aminoacyl-tRNA synthetases
      List of aminoacyl-tRNA synthetase entries
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again