Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 201 (29 Sep 2021)
Sequence version 3 (16 Apr 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Lysine--tRNA ligase

Gene

KARS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (PubMed:9278442, PubMed:18029264, PubMed:18272479).

When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages (PubMed:15851690).

Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity (PubMed:5338216, PubMed:14975237, PubMed:19524539, PubMed:23159739).

7 Publications

(Microbial infection) Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA3(Lys), the primer for reverse transcription initiation.

1 Publication

Miscellaneous

Shares a bidirectional promoter with TERF2IP/RAP1.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Up-regulated by DARS and EEF1A1, but not by AIMP2.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat is 0.31 (sec-1) for aminoacylation for tRNA(Lys).1 Publication
  1. KM=1.19 µM for tRNA(Lys)1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei277Substrate; via carbonyl oxygen2 Publications1
Binding sitei301Substrate3 Publications1
Binding sitei339Substrate3 Publications1
Binding sitei341Substrate3 Publications1
Binding sitei497Substrate3 Publications1
Binding sitei501Substrate3 Publications1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi323 – 325ATP1 Publication3
Nucleotide bindingi331 – 332ATP1 Publication2
Nucleotide bindingi494 – 495ATP1 Publication2
Nucleotide bindingi550 – 553ATP1 Publication4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAminoacyl-tRNA synthetase, Ligase, Transferase
Biological processHost-virus interaction, Protein biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
6.1.1.6, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q15046

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2408522, Selenoamino acid metabolism
R-HSA-379716, Cytosolic tRNA aminoacylation
R-HSA-379726, Mitochondrial tRNA aminoacylation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q15046

Protein family/group databases

MoonProt database of moonlighting proteins

More...
MoonProti
Q15046

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysine--tRNA ligase (EC:2.7.7.-3 Publications, EC:6.1.1.63 Publications)
Alternative name(s):
Lysyl-tRNA synthetase
Short name:
LysRS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KARS1Imported
Synonyms:KARS, KIAA0070
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6215, KARS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601421, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15046

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000065427

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Mitochondrion, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Charcot-Marie-Tooth disease, recessive, intermediate type, B (CMTRIB)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Recessive intermediate forms of Charcot-Marie-Tooth disease are characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064911105L → H in CMTRIB; severely affects enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607194EnsemblClinVar.1
Natural variantiVAR_064912274I → M in CMTRIB. 1 PublicationCorresponds to variant dbSNP:rs146955132Ensembl.1
Deafness, autosomal recessive, 89 (DFNB89)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of non-syndromic deafness characterized by bilateral, prelingual, moderate to severe hearing loss affecting all frequencies.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070233145Y → H in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514745Ensembl.1
Natural variantiVAR_070234349D → N in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514746Ensembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1 – 65Missing : Loss of nuclear localization, but no effect on packaging into HIV-1. 1 PublicationAdd BLAST65
Mutagenesisi101V → D, R or W: Disrupts interaction with AIMP2 and the multisynthase complex. 1 Publication1
Mutagenesisi207S → A: Strongly reduced production of diadenosine tetraphosphate (Ap4A). Reduced protein phosphorylation. 1 Publication1
Mutagenesisi207S → D: Phosphomimetic mutant that strongly enhances translocation into the nucleus and production of diadenosine tetraphosphate (Ap4A). Almost complete loss of tRNA ligase activity. 1 Publication1
Mutagenesisi207S → R: Strongly decreased tRNA ligase activity. 1 Publication1
Mutagenesisi207S → Y: Almost complete loss of tRNA ligase activity. 1 Publication1
Mutagenesisi346D → R: Induces protein aggregation. Releases from the subunit complex. 1 Publication1
Mutagenesisi540G → Y: Disrupts interaction with AIMP2 and the multisynthase complex. Increases production of diadenosine tetraphosphate (Ap4A). Almost complete loss of tRNA ligase activity. 1 Publication1

Keywords - Diseasei

Charcot-Marie-Tooth disease, Deafness, Disease variant, Neurodegeneration, Neuropathy, Non-syndromic deafness

Organism-specific databases

DisGeNET

More...
DisGeNETi
3735

MalaCards human disease database

More...
MalaCardsi
KARS1
MIMi613641, phenotype
613916, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000065427

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
254334, Autosomal recessive intermediate Charcot-Marie-Tooth disease type B
90636, Autosomal recessive non-syndromic sensorineural deafness type DFNB

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30016

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q15046, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5575

Drug and drug target database

More...
DrugBanki
DB00123, L-Lysine

DrugCentral

More...
DrugCentrali
Q15046

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KARS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20178333

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001527652 – 597Lysine--tRNA ligaseAdd BLAST596

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei88N6-acetyllysineCombined sources1
Modified residuei141N6-acetyllysineCombined sources1
Modified residuei207Phosphoserine1 Publication1
Modified residuei590PhosphoserineBy similarity1
Modified residuei591PhosphothreonineBy similarity1
Modified residuei596PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on a serine residue after mast cell stimulation with immunoglobulin E (IgE).By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-231

Encyclopedia of Proteome Dynamics

More...
EPDi
Q15046

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15046

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q15046

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15046

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15046

PeptideAtlas

More...
PeptideAtlasi
Q15046

PRoteomics IDEntifications database

More...
PRIDEi
Q15046

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60395 [Q15046-1]
60396 [Q15046-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q15046

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q15046, 2 sites, 1 O-linked glycan (2 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15046

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q15046

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15046

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q15046

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000065427, Expressed in thoracic mammary gland and 251 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15046, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15046, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000065427, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and tetradimer (PubMed:18272479, PubMed:23159739, PubMed:26074468, PubMed:28887846). Part of the multisynthetase complex (MSC), a multisubunit complex that groups tRNA ligases for Arg (RARS), Asp (DARS), Gln (QARS), Ile (IARS), Leu (LARS), Lys (KARS), Met (MARS) the bifunctional ligase for Glu and Pro (EPRS) and the auxiliary subunits AIMP1/p43, AIMP2/p38 and EEF1E1/p18 (PubMed:19131329, PubMed:19289464, PubMed:24312579, PubMed:23159739).

Interacts with AIMP2 (via N-terminus) and MITF (PubMed:9878398, PubMed:14975237, PubMed:15220430, PubMed:23159739, PubMed:26074468).

Interacts with TARSL2 (PubMed:24312579).

11 Publications

(Microbial infection) Interacts directly with HIV-1 virus GAG protein (PubMed:12756246, PubMed:15220430).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
109938, 235 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q15046

Database of interacting proteins

More...
DIPi
DIP-29725N

Protein interaction database and analysis system

More...
IntActi
Q15046, 67 interactors

Molecular INTeraction database

More...
MINTi
Q15046

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000325448

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q15046

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q15046, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1597
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q15046

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15046

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q15046

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 71DisorderedSequence analysisAdd BLAST71

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi13 – 44Basic and acidic residuesSequence analysisAdd BLAST32
Compositional biasi45 – 64Polar residuesSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal domain (1-65) of the cytoplasmic isoform is a functional tRNA-binding domain, is required for nuclear localization, is involved in the interaction with DARS, but has a repulsive role in the binding to EEF1A1. A central domain (208-259) is involved in homodimerization and is required for interaction with HIV-1 GAG and incorporation into virions. The C-terminal domain (452-597) is not required for interaction with AIMP2.2 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1885, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT01030000234618

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008255_6_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15046

Identification of Orthologs from Complete Genome Data

More...
OMAi
EIFGEKC

Database of Orthologous Groups

More...
OrthoDBi
837479at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15046

TreeFam database of animal gene trees

More...
TreeFami
TF300365

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00775, LysRS_core, 1 hit
cd04322, LysRS_N, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00252, Lys_tRNA_synth_class2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004364, Aa-tRNA-synt_II
IPR006195, aa-tRNA-synth_II
IPR002313, Lys-tRNA-ligase_II
IPR034762, Lys-tRNA-ligase_II_bac/euk
IPR044136, Lys-tRNA-ligase_II_N
IPR018149, Lys-tRNA-synth_II_C
IPR012340, NA-bd_OB-fold
IPR004365, NA-bd_OB_tRNA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00152, tRNA-synt_2, 1 hit
PF01336, tRNA_anti-codon, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF039101, LysRS2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00982, TRNASYNTHLYS

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50249, SSF50249, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00499, lysS_bact, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50862, AA_TRNA_LIGASE_II, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform Cytoplasmic (identifier: Q15046-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAVQAAEVK VDGSEPKLSK NELKRRLKAE KKVAEKEAKQ KELSEKQLSQ
60 70 80 90 100
ATAAATNHTT DNGVGPEEES VDPNQYYKIR SQAIHQLKVN GEDPYPHKFH
110 120 130 140 150
VDISLTDFIQ KYSHLQPGDH LTDITLKVAG RIHAKRASGG KLIFYDLRGE
160 170 180 190 200
GVKLQVMANS RNYKSEEEFI HINNKLRRGD IIGVQGNPGK TKKGELSIIP
210 220 230 240 250
YEITLLSPCL HMLPHLHFGL KDKETRYRQR YLDLILNDFV RQKFIIRSKI
260 270 280 290 300
ITYIRSFLDE LGFLEIETPM MNIIPGGAVA KPFITYHNEL DMNLYMRIAP
310 320 330 340 350
ELYHKMLVVG GIDRVYEIGR QFRNEGIDLT HNPEFTTCEF YMAYADYHDL
360 370 380 390 400
MEITEKMVSG MVKHITGSYK VTYHPDGPEG QAYDVDFTPP FRRINMVEEL
410 420 430 440 450
EKALGMKLPE TNLFETEETR KILDDICVAK AVECPPPRTT ARLLDKLVGE
460 470 480 490 500
FLEVTCINPT FICDHPQIMS PLAKWHRSKE GLTERFELFV MKKEICNAYT
510 520 530 540 550
ELNDPMRQRQ LFEEQAKAKA AGDDEAMFID ENFCTALEYG LPPTAGWGMG
560 570 580 590
IDRVAMFLTD SNNIKEVLLF PAMKPEDKKE NVATTDTLES TTVGTSV
Length:597
Mass (Da):68,048
Last modified:April 16, 2002 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE7770953332D905D
GO
Isoform Mitochondrial (identifier: Q15046-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MAAVQAAEVKVDGSEPKLSKN → MLTQAAVRLVRGSLRKTSWAEWGHRELRLGQLAPFTAPHKDKSFSDQRS

Note: Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 1-16.Curated
Show »
Length:625
Mass (Da):71,497
Checksum:i294DA1CE5A137AD6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BVA8H3BVA8_HUMAN
Lysyl-tRNA synthetase
KARS1
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPV7H3BPV7_HUMAN
Lysyl-tRNA synthetase
KARS1
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRL2J3KRL2_HUMAN
Lysyl-tRNA synthetase
KARS1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMR9H3BMR9_HUMAN
Lysine--tRNA ligase
KARS1
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRC9H3BRC9_HUMAN
Lysine--tRNA ligase
KARS1
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQK5H3BQK5_HUMAN
Lysine--tRNA ligase
KARS1
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSN6H3BSN6_HUMAN
Lysine--tRNA ligase
KARS1
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA06688 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform Mitochondrial (identifier: Q15046-2)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti48R → G in AAG30114 (PubMed:10952987).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064911105L → H in CMTRIB; severely affects enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607194EnsemblClinVar.1
Natural variantiVAR_070233145Y → H in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514745Ensembl.1
Natural variantiVAR_052640179G → A. Corresponds to variant dbSNP:rs11557665Ensembl.1
Natural variantiVAR_064912274I → M in CMTRIB. 1 PublicationCorresponds to variant dbSNP:rs146955132Ensembl.1
Natural variantiVAR_070234349D → N in DFNB89. 1 PublicationCorresponds to variant dbSNP:rs397514746Ensembl.1
Natural variantiVAR_079741350L → H Found in a patient with hypertrophic cardiomyopathy and mild intellectual disability together with proximal muscle weakness; unknown pathological significance. 1 Publication1
Natural variantiVAR_079742390P → R Found in a patient with hypertrophic cardiomyopathy and mild intellectual disability together with proximal muscle weakness; unknown pathological significance. 1 Publication1
Natural variantiVAR_079743438R → W Found in patients with severe infantile visual loss with progressive microcephaly and developmental delay as well as seizures and abnormal subcortical white matter; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs761527468Ensembl.1
Natural variantiVAR_079744477R → H Probable disease-associated variant found in a family with sensorineural hearing loss and leukoencephalopathy; decreases tRNA-lysine aminoacylation; induces protein aggregation; releases from the subunit complex; no effect on cytoplasmic location; no effect on oligomerization. 1 PublicationCorresponds to variant dbSNP:rs778748895EnsemblClinVar.1
Natural variantiVAR_079745505P → S Probable disease-associated variant found in a family with sensorineural hearing loss and leukoencephalopathy; decreases tRNA-lysine aminoacylation; slightly induces protein aggregation; no effect on cytoplasmic location; no effect on oligomerization. 1 PublicationCorresponds to variant dbSNP:rs1555512658EnsemblClinVar.1
Natural variantiVAR_079746525E → K Found in patients with severe infantile visual loss with progressive microcephaly and developmental delay as well as seizures and abnormal subcortical white matter; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs770522582Ensembl.1
Natural variantiVAR_016105595T → S3 PublicationsCorresponds to variant dbSNP:rs6834EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0384811 – 21MAAVQ…KLSKN → MLTQAAVRLVRGSLRKTSWA EWGHRELRLGQLAPFTAPHK DKSFSDQRS in isoform Mitochondrial. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D32053 mRNA Translation: BAA22084.1
AF285758 mRNA Translation: AAG30114.1
D31890 mRNA Translation: BAA06688.1 Different initiation.
AC025287 Genomic DNA No translation available.
CH471114 Genomic DNA Translation: EAW95622.1
CH471114 Genomic DNA Translation: EAW95624.1
BC004132 mRNA Translation: AAH04132.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10923.1 [Q15046-1]
CCDS45532.1 [Q15046-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001123561.1, NM_001130089.1 [Q15046-2]
NP_005539.1, NM_005548.2 [Q15046-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000302445; ENSP00000303043; ENSG00000065427 [Q15046-1]
ENST00000319410; ENSP00000325448; ENSG00000065427 [Q15046-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3735

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3735

UCSC genome browser

More...
UCSCi
uc002feq.4, human [Q15046-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D32053 mRNA Translation: BAA22084.1
AF285758 mRNA Translation: AAG30114.1
D31890 mRNA Translation: BAA06688.1 Different initiation.
AC025287 Genomic DNA No translation available.
CH471114 Genomic DNA Translation: EAW95622.1
CH471114 Genomic DNA Translation: EAW95624.1
BC004132 mRNA Translation: AAH04132.1
CCDSiCCDS10923.1 [Q15046-1]
CCDS45532.1 [Q15046-2]
RefSeqiNP_001123561.1, NM_001130089.1 [Q15046-2]
NP_005539.1, NM_005548.2 [Q15046-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3BJUX-ray2.31A/B/C/D70-582[»]
4DPGX-ray2.84A/B/C/D/E/F/G/H70-581[»]
4YCUX-ray2.10A/B70-581[»]
4YCWX-ray2.90A/B/E/F70-581[»]
6CHDX-ray2.50A/B1-597[»]
6ILDX-ray1.88A/B70-581[»]
6ILHX-ray2.50A/B70-581[»]
7EA9X-ray2.50A/B/C/D70-581[»]
BMRBiQ15046
SMRiQ15046
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109938, 235 interactors
CORUMiQ15046
DIPiDIP-29725N
IntActiQ15046, 67 interactors
MINTiQ15046
STRINGi9606.ENSP00000325448

Chemistry databases

BindingDBiQ15046
ChEMBLiCHEMBL5575
DrugBankiDB00123, L-Lysine
DrugCentraliQ15046

Protein family/group databases

MoonProtiQ15046

PTM databases

CarbonylDBiQ15046
GlyGeniQ15046, 2 sites, 1 O-linked glycan (2 sites)
iPTMnetiQ15046
MetOSiteiQ15046
PhosphoSitePlusiQ15046
SwissPalmiQ15046

Genetic variation databases

BioMutaiKARS
DMDMi20178333

Proteomic databases

CPTACiCPTAC-231
EPDiQ15046
jPOSTiQ15046
MassIVEiQ15046
MaxQBiQ15046
PaxDbiQ15046
PeptideAtlasiQ15046
PRIDEiQ15046
ProteomicsDBi60395 [Q15046-1]
60396 [Q15046-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q15046, 3 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
16841, 234 antibodies

The DNASU plasmid repository

More...
DNASUi
3735

Genome annotation databases

EnsembliENST00000302445; ENSP00000303043; ENSG00000065427 [Q15046-1]
ENST00000319410; ENSP00000325448; ENSG00000065427 [Q15046-2]
GeneIDi3735
KEGGihsa:3735
UCSCiuc002feq.4, human [Q15046-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3735
DisGeNETi3735

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KARS1
HGNCiHGNC:6215, KARS1
HPAiENSG00000065427, Low tissue specificity
MalaCardsiKARS1
MIMi601421, gene
613641, phenotype
613916, phenotype
neXtProtiNX_Q15046
OpenTargetsiENSG00000065427
Orphaneti254334, Autosomal recessive intermediate Charcot-Marie-Tooth disease type B
90636, Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBiPA30016
VEuPathDBiHostDB:ENSG00000065427

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1885, Eukaryota
GeneTreeiENSGT01030000234618
HOGENOMiCLU_008255_6_0_1
InParanoidiQ15046
OMAiEIFGEKC
OrthoDBi837479at2759
PhylomeDBiQ15046
TreeFamiTF300365

Enzyme and pathway databases

BRENDAi6.1.1.6, 2681
PathwayCommonsiQ15046
ReactomeiR-HSA-2408522, Selenoamino acid metabolism
R-HSA-379716, Cytosolic tRNA aminoacylation
R-HSA-379726, Mitochondrial tRNA aminoacylation
SIGNORiQ15046

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
3735, 785 hits in 1026 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KARS, human
EvolutionaryTraceiQ15046

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KARS_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3735
PharosiQ15046, Tchem

Protein Ontology

More...
PROi
PR:Q15046
RNActiQ15046, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000065427, Expressed in thoracic mammary gland and 251 other tissues
ExpressionAtlasiQ15046, baseline and differential
GenevisibleiQ15046, HS

Family and domain databases

CDDicd00775, LysRS_core, 1 hit
cd04322, LysRS_N, 1 hit
HAMAPiMF_00252, Lys_tRNA_synth_class2, 1 hit
InterProiView protein in InterPro
IPR004364, Aa-tRNA-synt_II
IPR006195, aa-tRNA-synth_II
IPR002313, Lys-tRNA-ligase_II
IPR034762, Lys-tRNA-ligase_II_bac/euk
IPR044136, Lys-tRNA-ligase_II_N
IPR018149, Lys-tRNA-synth_II_C
IPR012340, NA-bd_OB-fold
IPR004365, NA-bd_OB_tRNA
PfamiView protein in Pfam
PF00152, tRNA-synt_2, 1 hit
PF01336, tRNA_anti-codon, 1 hit
PIRSFiPIRSF039101, LysRS2, 1 hit
PRINTSiPR00982, TRNASYNTHLYS
SUPFAMiSSF50249, SSF50249, 1 hit
TIGRFAMsiTIGR00499, lysS_bact, 1 hit
PROSITEiView protein in PROSITE
PS50862, AA_TRNA_LIGASE_II, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYK_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15046
Secondary accession number(s): A8MSK1
, D3DUK4, O14946, Q96J25, Q9HB23
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 16, 2002
Last modified: September 29, 2021
This is version 201 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again