Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (18 Sep 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rab3 GTPase-activating protein catalytic subunit

Gene

RAB3GAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable catalytic subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Specifically converts active Rab3-GTP to the inactive form Rab3-GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters.2 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=75 µM for GTP-loaded RAB3A1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionGTPase activation

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
    R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q15042

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Rab3 GTPase-activating protein catalytic subunit
    Alternative name(s):
    RAB3 GTPase-activating protein 130 kDa subunit
    Rab3-GAP p130
    Short name:
    Rab3-GAP
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:RAB3GAP1
    Synonyms:KIAA0066, RAB3GAP
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:17063 RAB3GAP1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    602536 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q15042

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Warburg micro syndrome 1 (WARBM1)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism.
    Related information in OMIM

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi619R → A: No effect. 1 Publication1
    Mutagenesisi700R → A: No effect. 1 Publication1
    Mutagenesisi728R → A: Loss of function. 1 Publication1
    Mutagenesisi753R → A: No effect. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    22930

    GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

    More...
    GeneReviewsi
    RAB3GAP1

    MalaCards human disease database

    More...
    MalaCardsi
    RAB3GAP1
    MIMi600118 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000115839

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    1387 Cataract-intellectual disability-hypogonadism syndrome
    2510 Micro syndrome

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134969639

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    RAB3GAP1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    62511099

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001916551 – 981Rab3 GTPase-activating protein catalytic subunitAdd BLAST981

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei83PhosphoserineBy similarity1
    Modified residuei379PhosphoserineCombined sources1
    Modified residuei537PhosphoserineCombined sources1
    Modified residuei579PhosphoserineBy similarity1
    Modified residuei581PhosphoserineBy similarity1
    Modified residuei590PhosphoserineCombined sources1
    Modified residuei664PhosphoserineCombined sources1
    Modified residuei908PhosphothreonineCombined sources1

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q15042

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q15042

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q15042

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q15042

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q15042

    PeptideAtlas

    More...
    PeptideAtlasi
    Q15042

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q15042

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    60390 [Q15042-1]
    789
    8989

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q15042

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q15042

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q15042

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Ubiquitous.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000115839 Expressed in 244 organ(s), highest expression level in Brodmann (1909) area 23

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q15042 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q15042 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA034494
    HPA034495

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    The Rab3 GTPase-activating complex is a heterodimer composed of RAB3GAP and RAB3-GAP150. The Rab3 GTPase-activating complex interacts with DMXL2 (By similarity).

    Interacts with LMAN1 (PubMed:22337587).

    By similarity1 Publication

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    116590, 43 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q15042, 19 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000411418

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the Rab3-GAP catalytic subunit family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2390 Eukaryota
    ENOG410Y2R4 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00390000006705

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000253924

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q15042

    KEGG Orthology (KO)

    More...
    KOi
    K18270

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    EEYNLYN

    Database of Orthologous Groups

    More...
    OrthoDBi
    236283at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q15042

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF314500

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR026147 Rab3-GAP_cat_su

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR21422 PTHR21422, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF13890 Rab3-GTPase_cat, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q15042-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MAADSEPESE VFEITDFTTA SEWERFISKV EEVLNDWKLI GNSLGKPLEK
    60 70 80 90 100
    GIFTSGTWEE KSDEISFADF KFSVTHHYLV QESTDKEGKD ELLEDVVPQS
    110 120 130 140 150
    MQDLLGMNND FPPRAHCLVR WYGLREFVVI APAAHSDAVL SESKCNLLLS
    160 170 180 190 200
    SVSIALGNTG CQVPLFVQIH HKWRRMYVGE CQGPGVRTDF EMVHLRKVPN
    210 220 230 240 250
    QYTHLSGLLD IFKSKIGCPL TPLPPVSIAI RFTYVLQDWQ QYFWPQQPPD
    260 270 280 290 300
    IDALVGGEVG GLEFGKLPFG ACEDPISELH LATTWPHLTE GIIVDNDVYS
    310 320 330 340 350
    DLDPIQAPHW SVRVRKAENP QCLLGDFVTE FFKICRRKES TDEILGRSAF
    360 370 380 390 400
    EEEGKETADI THALSKLTEP ASVPIHKLSV SNMVHTAKKK IRKHRGVEES
    410 420 430 440 450
    PLNNDVLNTI LLFLFPDAVS EKPLDGTTST DNNNPPSESE DYNLYNQFKS
    460 470 480 490 500
    APSDSLTYKL ALCLCMINFY HGGLKGVAHL WQEFVLEMRF RWENNFLIPG
    510 520 530 540 550
    LASGPPDLRC CLLHQKLQML NCCIERKKAR DEGKKTSASD VTNIYPGDAG
    560 570 580 590 600
    KAGDQLVPDN LKETDKEKGE VGKSWDSWSD SEEEFFECLS DTEELKGNGQ
    610 620 630 640 650
    ESGKKGGPKE MANLRPEGRL YQHGKLTLLH NGEPLYIPVT QEPAPMTEDL
    660 670 680 690 700
    LEEQSEVLAK LGTSAEGAHL RARMQSACLL SDMESFKAAN PGCSLEDFVR
    710 720 730 740 750
    WYSPRDYIEE EVIDEKGNVV LKGELSARMK IPSNMWVEAW ETAKPIPARR
    760 770 780 790 800
    QRRLFDDTRE AEKVLHYLAI QKPADLARHL LPCVIHAAVL KVKEEESLEN
    810 820 830 840 850
    ISSVKKIIKQ IISHSSKVLH FPNPEDKKLE EIIHQITNVE ALIARARSLK
    860 870 880 890 900
    AKFGTEKCEQ EEEKEDLERF VSCLLEQPEV LVTGAGRGHA GRIIHKLFVN
    910 920 930 940 950
    AQRAAAMTPP EEELKRMGSP EERRQNSVSD FPPPAGREFI LRTTVPRPAP
    960 970 980
    YSKALPQRMY SVLTKEDFRL AGAFSSDTSF F
    Length:981
    Mass (Da):110,524
    Last modified:January 23, 2007 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0673611C5C49641C
    GO
    Isoform 2 (identifier: Q15042-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         903-903: R → RLTESSDE

    Note: No experimental confirmation available.
    Show »
    Length:988
    Mass (Da):111,285
    Checksum:i53B04747CCD4B2D8
    GO
    Isoform 3 (identifier: Q15042-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MAADSEPESEVFEITDFTTASEWERFISKVEEVLNDWKLIGNSLGKPLEK → MFSLIS
         972-981: GAFSSDTSFF → VKIIDGDV

    Note: No experimental confirmation available.
    Show »
    Length:935
    Mass (Da):105,296
    Checksum:i15466F1985DFFB72
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    C9J1R5C9J1R5_HUMAN
    Rab3 GTPase-activating protein cata...
    RAB3GAP1
    58Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BC071602 differs from that shown. Reason: Frameshift at position 211.Curated
    The sequence CAH56411 differs from that shown. Probable cloning artifact.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051716598N → S1 PublicationCorresponds to variant dbSNP:rs10445686EnsemblClinVar.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0544751 – 50MAADS…KPLEK → MFSLIS in isoform 3. 1 PublicationAdd BLAST50
    Alternative sequenceiVSP_054068903R → RLTESSDE in isoform 2. 1 Publication1
    Alternative sequenceiVSP_054476972 – 981GAFSSDTSFF → VKIIDGDV in isoform 3. 1 Publication10

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    D31886 mRNA Translation: BAA06684.1
    AC017031 Genomic DNA No translation available.
    AC020602 Genomic DNA No translation available.
    BC022977 mRNA Translation: AAH22977.1
    BC071602 mRNA No translation available.
    BC146809 mRNA Translation: AAI46810.1
    AL096752 mRNA Translation: CAH56411.1 Sequence problems.

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS33294.1 [Q15042-1]
    CCDS54402.1 [Q15042-3]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001165906.1, NM_001172435.1 [Q15042-3]
    NP_036365.1, NM_012233.2 [Q15042-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000264158; ENSP00000264158; ENSG00000115839 [Q15042-1]
    ENST00000442034; ENSP00000411418; ENSG00000115839 [Q15042-3]
    ENST00000539493; ENSP00000444306; ENSG00000115839 [Q15042-4]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    22930

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:22930

    UCSC genome browser

    More...
    UCSCi
    uc002tuj.4 human [Q15042-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    D31886 mRNA Translation: BAA06684.1
    AC017031 Genomic DNA No translation available.
    AC020602 Genomic DNA No translation available.
    BC022977 mRNA Translation: AAH22977.1
    BC071602 mRNA No translation available.
    BC146809 mRNA Translation: AAI46810.1
    AL096752 mRNA Translation: CAH56411.1 Sequence problems.
    CCDSiCCDS33294.1 [Q15042-1]
    CCDS54402.1 [Q15042-3]
    RefSeqiNP_001165906.1, NM_001172435.1 [Q15042-3]
    NP_036365.1, NM_012233.2 [Q15042-1]

    3D structure databases

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    SWISS-MODEL Interactive Workspace

    More...
    SWISS-MODEL-Workspacei
    Submit a new modelling project...

    Protein-protein interaction databases

    BioGridi116590, 43 interactors
    IntActiQ15042, 19 interactors
    STRINGi9606.ENSP00000411418

    PTM databases

    iPTMnetiQ15042
    PhosphoSitePlusiQ15042
    SwissPalmiQ15042

    Polymorphism and mutation databases

    BioMutaiRAB3GAP1
    DMDMi62511099

    Proteomic databases

    EPDiQ15042
    jPOSTiQ15042
    MassIVEiQ15042
    MaxQBiQ15042
    PaxDbiQ15042
    PeptideAtlasiQ15042
    PRIDEiQ15042
    ProteomicsDBi60390 [Q15042-1]
    789
    8989

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000264158; ENSP00000264158; ENSG00000115839 [Q15042-1]
    ENST00000442034; ENSP00000411418; ENSG00000115839 [Q15042-3]
    ENST00000539493; ENSP00000444306; ENSG00000115839 [Q15042-4]
    GeneIDi22930
    KEGGihsa:22930
    UCSCiuc002tuj.4 human [Q15042-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    22930
    DisGeNETi22930

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    RAB3GAP1
    GeneReviewsiRAB3GAP1
    HGNCiHGNC:17063 RAB3GAP1
    HPAiHPA034494
    HPA034495
    MalaCardsiRAB3GAP1
    MIMi600118 phenotype
    602536 gene
    neXtProtiNX_Q15042
    OpenTargetsiENSG00000115839
    Orphaneti1387 Cataract-intellectual disability-hypogonadism syndrome
    2510 Micro syndrome
    PharmGKBiPA134969639

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG2390 Eukaryota
    ENOG410Y2R4 LUCA
    GeneTreeiENSGT00390000006705
    HOGENOMiHOG000253924
    InParanoidiQ15042
    KOiK18270
    OMAiEEYNLYN
    OrthoDBi236283at2759
    PhylomeDBiQ15042
    TreeFamiTF314500

    Enzyme and pathway databases

    ReactomeiR-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
    R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs
    SABIO-RKiQ15042

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    RAB3GAP1 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    RAB3GAP1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    22930

    Pharos

    More...
    Pharosi
    Q15042

    Protein Ontology

    More...
    PROi
    PR:Q15042

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000115839 Expressed in 244 organ(s), highest expression level in Brodmann (1909) area 23
    ExpressionAtlasiQ15042 baseline and differential
    GenevisibleiQ15042 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR026147 Rab3-GAP_cat_su
    PANTHERiPTHR21422 PTHR21422, 1 hit
    PfamiView protein in Pfam
    PF13890 Rab3-GTPase_cat, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRB3GP_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15042
    Secondary accession number(s): A6H8Z3
    , C9J837, Q659F5, Q8TBB4
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
    Last sequence update: January 23, 2007
    Last modified: September 18, 2019
    This is version 147 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again