Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (12 Aug 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DAZ-associated protein 2

Gene

DAZAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q15038

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q15038, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DAZ-associated protein 2
Alternative name(s):
Deleted in azoospermia-associated protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DAZAP2
Synonyms:KIAA0058
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000183283.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2684, DAZAP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607431, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q15038

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9802

Open Targets

More...
OpenTargetsi
ENSG00000183283

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27154

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q15038, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DAZAP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
44887865

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000797881 – 168DAZ-associated protein 2Add BLAST168

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by SMURF2, leading to proteasomal degradation.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q15038

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q15038

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q15038

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q15038

PeptideAtlas

More...
PeptideAtlasi
Q15038

PRoteomics IDEntifications database

More...
PRIDEi
Q15038

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
11080
19140
28699
60386 [Q15038-1]
60387 [Q15038-2]
9296

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q15038

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q15038

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000183283, Expressed in blood and 245 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q15038, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q15038, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000183283, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SOX6 (By similarity).

Interacts with DAZ and DAZL.

Interacts with IL17RB. May interact with FAM168B.

Interacts with INCA1 (PubMed:21750715).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q15038
With#Exp.IntAct
ACOT7 - isoform 4 [O00154-4]3EBI-724310,EBI-12007918
AOC1 [P19801]3EBI-724310,EBI-12826295
ARID5A [Q03989]8EBI-724310,EBI-948603
ATXN1 [P54253]2EBI-724310,EBI-930964
BAG3 [O95817]9EBI-724310,EBI-747185
BATF2 [Q8N1L9]3EBI-724310,EBI-742695
BHLHE40 [O14503]5EBI-724310,EBI-711810
C1orf94 [Q6P1W5]7EBI-724310,EBI-946029
CALCOCO2 [Q13137]4EBI-724310,EBI-739580
CAMK2A [Q9UQM7]3EBI-724310,EBI-1383687
CAPN15 [O75808]3EBI-724310,EBI-6149008
CELF5 [Q8N6W0]6EBI-724310,EBI-12139335
CELF6 - isoform 2 [Q96J87-2]3EBI-724310,EBI-12832044
CFAP36 [Q96G28]3EBI-724310,EBI-2654750
DAB1 [O75553]3EBI-724310,EBI-7875264
itself7EBI-724310,EBI-724310
DCUN1D1 [Q96GG9]9EBI-724310,EBI-740086
DESI1 [Q6ICB0]5EBI-724310,EBI-2806959
DTX2 [Q86UW9]3EBI-724310,EBI-740376
EPN1 [Q9Y6I3]3EBI-724310,EBI-713198
EPN1 - isoform 3 [Q9Y6I3-3]3EBI-724310,EBI-12026538
EPN2 - isoform 2 [O95208-2]5EBI-724310,EBI-12135243
EPN3 [I6L9I8]5EBI-724310,EBI-12866582
ESRP1 [Q6NXG1]3EBI-724310,EBI-10213520
EXD3 [Q8N9H8]3EBI-724310,EBI-750745
FAM168A [Q92567]3EBI-724310,EBI-7957930
FAM168A - isoform 2 [Q92567-2]5EBI-724310,EBI-11978259
FAM83A [Q86UY5]3EBI-724310,EBI-1384254
FOXD4L1 [Q9NU39]3EBI-724310,EBI-11320806
FOXH1 [O75593]5EBI-724310,EBI-1759806
GGA3 - isoform Short [Q9NZ52-2]3EBI-724310,EBI-12075758
GPS2 [Q13227]3EBI-724310,EBI-713355
HEMK1 [Q9Y5R4]3EBI-724310,EBI-10329202
HEY1 [Q9Y5J3]3EBI-724310,EBI-7231130
HGS [O14964]9EBI-724310,EBI-740220
HIP1 [O00291]4EBI-724310,EBI-473886
HSFY2 [Q96LI6]3EBI-724310,EBI-3957665
INCA1 [Q0VD86]2EBI-724310,EBI-6509505
ISX [Q2M1V0]3EBI-724310,EBI-6426064
KLHL42 [Q9P2K6]3EBI-724310,EBI-739890
KRTAP15-1 [Q3LI76]5EBI-724310,EBI-11992140
KRTAP19-1 [Q8IUB9]3EBI-724310,EBI-12811111
KRTAP19-3 [Q7Z4W3]6EBI-724310,EBI-12020132
KRTAP19-5 [Q3LI72]11EBI-724310,EBI-1048945
KRTAP19-7 [Q3SYF9]3EBI-724310,EBI-10241353
KRTAP26-1 [Q6PEX3]3EBI-724310,EBI-3957672
KRTAP6-1 [Q3LI64]8EBI-724310,EBI-12111050
KRTAP6-2 [Q3LI66]3EBI-724310,EBI-11962084
KRTAP8-1 [Q8IUC2]6EBI-724310,EBI-10261141
LASP1 - isoform 2 [Q14847-2]5EBI-724310,EBI-9088686
LGALS9 - isoform 2 [O00182-2]3EBI-724310,EBI-12130578
LITAF [Q99732]5EBI-724310,EBI-725647
MAGED1 [Q9Y5V3]4EBI-724310,EBI-716006
MAPK1IP1L [Q8NDC0]3EBI-724310,EBI-741424
MINDY1 - isoform 3 [Q8N5J2-3]3EBI-724310,EBI-12382151
MINDY3 [Q9H8M7]3EBI-724310,EBI-724928
MTURN [Q8N3F0]5EBI-724310,EBI-11980301
MYEOV [Q96EZ4]3EBI-724310,EBI-12260130
MYOZ3 [Q8TDC0]3EBI-724310,EBI-5662487
NAF1 [Q96HR8]3EBI-724310,EBI-2515597
NEDD4L [Q96PU5]3EBI-724310,EBI-717962
NEDD4L - isoform 2 [Q96PU5-2]3EBI-724310,EBI-6955201
OPTN [Q96CV9]6EBI-724310,EBI-748974
OTUB2 [Q96DC9]5EBI-724310,EBI-746259
OTUD7B [Q6GQQ9]3EBI-724310,EBI-527784
OTULIN [Q96BN8]6EBI-724310,EBI-750730
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-724310,EBI-11022007
PDIK1L [Q8N165]3EBI-724310,EBI-6423298
PEF1 [Q9UBV8]6EBI-724310,EBI-724639
PITX2 - isoform PTX2C [Q99697-2]3EBI-724310,EBI-12138495
PLEKHB2 [Q96CS7]11EBI-724310,EBI-373552
PLEKHF2 [Q9H8W4]3EBI-724310,EBI-742388
PLSCR1 [O15162]4EBI-724310,EBI-740019
PLSCR4 [Q9NRQ2]3EBI-724310,EBI-769257
POGZ [Q7Z3K3]8EBI-724310,EBI-1389308
POLI [Q9UNA4]3EBI-724310,EBI-741774
PROP1 [O75360]3EBI-724310,EBI-9027467
PRR13 [Q9NZ81]3EBI-724310,EBI-740924
PRR20C [P86479]4EBI-724310,EBI-10172814
PRR20D [P86480]5EBI-724310,EBI-12754095
PRR34 [Q9NV39]3EBI-724310,EBI-11959565
RABGEF1 [Q9UJ41]3EBI-724310,EBI-913954
RABGEF1 - isoform 3 [Q9UJ41-4]6EBI-724310,EBI-14093916
RAD18 [Q9NS91]3EBI-724310,EBI-2339393
RAD23A [P54725]3EBI-724310,EBI-746453
RAMAC [Q9BTL3]3EBI-724310,EBI-744023
RBFOX1 - isoform 5 [Q9NWB1-5]4EBI-724310,EBI-12123390
RBFOX2 [O43251]4EBI-724310,EBI-746056
RBFOX2 - isoform 10 [O43251-10]4EBI-724310,EBI-11963050
RBM24 - isoform 2 [Q9BX46-2]3EBI-724310,EBI-12224445
RBM43 [Q6ZSC3]3EBI-724310,EBI-2880658
RBPMS [Q93062]6EBI-724310,EBI-740322
RBPMS - isoform C [Q93062-3]7EBI-724310,EBI-740343
RHOXF2 [Q9BQY4]12EBI-724310,EBI-372094
RNF115 [Q9Y4L5]5EBI-724310,EBI-2129242
RNF208 [Q9H0X6]10EBI-724310,EBI-751555
RNF44 [Q7L0R7]3EBI-724310,EBI-2845060
ROR2 [A1L4F5]3EBI-724310,EBI-10172778
ROR2 [Q01974]8EBI-724310,EBI-6422642
RPS27A [P62979]9EBI-724310,EBI-357375
SMAP2 [Q8WU79]6EBI-724310,EBI-2822515
SNRPC [P09234]3EBI-724310,EBI-766589
SOX10 [P56693]3EBI-724310,EBI-1167533
SQSTM1 [Q13501]4EBI-724310,EBI-307104
STAM2 [O75886]7EBI-724310,EBI-373258
TAX1BP1 [Q86VP1]6EBI-724310,EBI-529518
TBX6 [O95947]3EBI-724310,EBI-2824328
TENT5B [Q96A09]7EBI-724310,EBI-752030
TEX37 [Q96LM6]9EBI-724310,EBI-743976
TFG [Q92734]5EBI-724310,EBI-357061
TIAL1 - isoform 2 [Q01085-2]5EBI-724310,EBI-11064654
TLE5 - isoform 2 [Q08117-2]3EBI-724310,EBI-11741437
TNIP1 [Q15025]3EBI-724310,EBI-357849
TNIP3 [Q96KP6]9EBI-724310,EBI-2509913
TOLLIP [Q6FIE9]3EBI-724310,EBI-10249783
TOLLIP [Q9H0E2]11EBI-724310,EBI-74615
TOM1 - isoform 2 [O60784-2]3EBI-724310,EBI-12117154
UBA52 [P62987]7EBI-724310,EBI-357304
UBAC1 [Q9BSL1]7EBI-724310,EBI-749370
UBAP2 [Q5T6F2]3EBI-724310,EBI-2514383
UBASH3A [P57075]4EBI-724310,EBI-2105393
UBASH3A - isoform 2 [P57075-2]3EBI-724310,EBI-7353612
UBASH3B [Q8TF42]6EBI-724310,EBI-1380492
UBB [P0CG47]7EBI-724310,EBI-413034
UBB [Q5U5U6]3EBI-724310,EBI-1642104
UBC [P0CG48]6EBI-724310,EBI-3390054
UBC [Q96C32]4EBI-724310,EBI-745483
UBE2D4 [Q9Y2X8]3EBI-724310,EBI-745527
UBE2E2 [Q96LR5]3EBI-724310,EBI-2129763
UBE2E3 [Q969T4]3EBI-724310,EBI-348496
UBE2V1 [Q13404]3EBI-724310,EBI-1050671
UBQLN1 [Q9UMX0]3EBI-724310,EBI-741480
UBQLN2 [Q9UHD9]3EBI-724310,EBI-947187
UBXN6 [Q9BZV1]5EBI-724310,EBI-1993899
UBXN7 [O94888]3EBI-724310,EBI-1993627
USP13 [Q92995]3EBI-724310,EBI-714351
USP5 [P45974]3EBI-724310,EBI-741277
VENTX [O95231]3EBI-724310,EBI-10191303
VEZF1 [Q14119]3EBI-724310,EBI-11980193
VHLL [Q6RSH7]8EBI-724310,EBI-10254232
VPS37C [A5D8V6]6EBI-724310,EBI-2559305
WWOX - isoform 5 [Q9NZC7-5]6EBI-724310,EBI-12040603
YOD1 [Q5VVQ6]7EBI-724310,EBI-2510804
ZBTB32 [A0A0C4DGF1]5EBI-724310,EBI-10188476
ZC3H10 [Q96K80]7EBI-724310,EBI-742550
ZFAND2A [Q8N6M9]3EBI-724310,EBI-3921109
ZFAND2B [Q8WV99]10EBI-724310,EBI-747823

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115143, 106 interactors

Protein interaction database and analysis system

More...
IntActi
Q15038, 180 interactors

Molecular INTeraction database

More...
MINTi
Q15038

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000448051

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q15038, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q15038

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi8 – 134Pro-richAdd BLAST127

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTNQ, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000685

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1325998_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q15038

Identification of Orthologs from Complete Genome Data

More...
OMAi
SVPMAYY

Database of Orthologous Groups

More...
OrthoDBi
1175298at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q15038

TreeFam database of animal gene trees

More...
TreeFami
TF329672

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022730, DAZ_assoc-2

The PANTHER Classification System

More...
PANTHERi
PTHR31638, PTHR31638, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11029, DAZAP2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15038-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSKGQYPTQ PTYPVQPPGN PVYPQTLHLP QAPPYTDAPP AYSELYRPSF
60 70 80 90 100
VHPGAATVPT MSAAFPGASL YLPMAQSVAV GPLGSTIPMA YYPVGPIYPP
110 120 130 140 150
GSTVLVEGGY DAGARFGAGA TAGNIPPPPP GCPPNAAQLA VMQGANVLVT
160
QRKGNFFMGG SDGGYTIW
Length:168
Mass (Da):17,319
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49F1B6D281E24AAC
GO
Isoform 2 (identifier: Q15038-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM

Show »
Length:153
Mass (Da):16,187
Checksum:iFAF1904AF43CA4E4
GO
Isoform 6 (identifier: Q15038-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-86: Missing.

Show »
Length:146
Mass (Da):15,173
Checksum:i3EA0DB83FB16A1A8
GO
Isoform 3 (identifier: Q15038-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-76: Missing.

Show »
Length:136
Mass (Da):13,987
Checksum:i46E379CE7F8A3A04
GO
Isoform 4 (identifier: Q15038-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-126: Missing.

Show »
Length:86
Mass (Da):9,167
Checksum:i5A99269B0CBA9174
GO
Isoform 5 (identifier: Q15038-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-168: GSTVLVEGGY...GGSDGGYTIW → ASTSWMPSQC...RNHVMVAVPP

Show »
Length:207
Mass (Da):22,823
Checksum:i24B6E3CC46C33150
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3Q0S4R3Q0_HUMAN
DAZ-associated protein 2
DAZAP2
134Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUW5F8VUW5_HUMAN
DAZ-associated protein 2
DAZAP2
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PE89E9PE89_HUMAN
DAZ-associated protein 2
DAZAP2
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA06545 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29L → P in BAG64775 (PubMed:14702039).Curated1
Sequence conflicti47R → S in AAR11454 (PubMed:17935665).Curated1
Sequence conflicti90A → V in BU662353 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061639102S → A. Corresponds to variant dbSNP:rs57917280Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04567845 – 126Missing in isoform 4. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_04567945 – 76Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05518165 – 86Missing in isoform 6. CuratedAdd BLAST22
Alternative sequenceiVSP_046764101 – 168GSTVL…GYTIW → ASTSWMPSQCCSACSHAGSQ RPRNSAEGELLHGWFRWWLH HLVRNQGHLCAGKDITYLQH FSQCNCFSHINLKLQFRHML LGCLSGAQTFRHFSNLIRNH VMVAVPP in isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_042773127 – 168PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY430097 mRNA Translation: AAR11454.1
BU662353 mRNA No translation available.
D31767 mRNA Translation: BAA06545.2 Different initiation.
BX441137 mRNA No translation available.
AK095963 mRNA No translation available.
AK290119 mRNA Translation: BAF82808.1
AK293330 mRNA Translation: BAG56846.1
AK303828 mRNA Translation: BAG64775.1
AC046135 Genomic DNA No translation available.
AC139768 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58181.1
BC002334 mRNA Translation: AAH02334.1
BC007900 mRNA Translation: AAH07900.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44884.1 [Q15038-2]
CCDS44885.1 [Q15038-5]
CCDS44886.1 [Q15038-6]
CCDS44887.1 [Q15038-3]
CCDS44888.1 [Q15038-4]
CCDS8809.1 [Q15038-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129736.1, NM_001136264.1 [Q15038-6]
NP_001129738.1, NM_001136266.1 [Q15038-5]
NP_001129739.1, NM_001136267.1 [Q15038-3]
NP_001129740.1, NM_001136268.1 [Q15038-4]
NP_001129741.1, NM_001136269.1 [Q15038-2]
NP_055579.1, NM_014764.3 [Q15038-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000412716; ENSP00000394699; ENSG00000183283 [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283 [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283 [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283 [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283 [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283 [Q15038-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9802

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9802

UCSC genome browser

More...
UCSCi
uc001ryb.4, human [Q15038-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY430097 mRNA Translation: AAR11454.1
BU662353 mRNA No translation available.
D31767 mRNA Translation: BAA06545.2 Different initiation.
BX441137 mRNA No translation available.
AK095963 mRNA No translation available.
AK290119 mRNA Translation: BAF82808.1
AK293330 mRNA Translation: BAG56846.1
AK303828 mRNA Translation: BAG64775.1
AC046135 Genomic DNA No translation available.
AC139768 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58181.1
BC002334 mRNA Translation: AAH02334.1
BC007900 mRNA Translation: AAH07900.1
CCDSiCCDS44884.1 [Q15038-2]
CCDS44885.1 [Q15038-5]
CCDS44886.1 [Q15038-6]
CCDS44887.1 [Q15038-3]
CCDS44888.1 [Q15038-4]
CCDS8809.1 [Q15038-1]
RefSeqiNP_001129736.1, NM_001136264.1 [Q15038-6]
NP_001129738.1, NM_001136266.1 [Q15038-5]
NP_001129739.1, NM_001136267.1 [Q15038-3]
NP_001129740.1, NM_001136268.1 [Q15038-4]
NP_001129741.1, NM_001136269.1 [Q15038-2]
NP_055579.1, NM_014764.3 [Q15038-1]

3D structure databases

SMRiQ15038
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115143, 106 interactors
IntActiQ15038, 180 interactors
MINTiQ15038
STRINGi9606.ENSP00000448051

Protein family/group databases

MoonDBiQ15038, Predicted

PTM databases

iPTMnetiQ15038
PhosphoSitePlusiQ15038

Polymorphism and mutation databases

BioMutaiDAZAP2
DMDMi44887865

Proteomic databases

jPOSTiQ15038
MassIVEiQ15038
MaxQBiQ15038
PaxDbiQ15038
PeptideAtlasiQ15038
PRIDEiQ15038
ProteomicsDBi11080
19140
28699
60386 [Q15038-1]
60387 [Q15038-2]
9296

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26360, 104 antibodies

The DNASU plasmid repository

More...
DNASUi
9802

Genome annotation databases

EnsembliENST00000412716; ENSP00000394699; ENSG00000183283 [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283 [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283 [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283 [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283 [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283 [Q15038-3]
GeneIDi9802
KEGGihsa:9802
UCSCiuc001ryb.4, human [Q15038-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9802
DisGeNETi9802
EuPathDBiHostDB:ENSG00000183283.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DAZAP2
HGNCiHGNC:2684, DAZAP2
HPAiENSG00000183283, Low tissue specificity
MIMi607431, gene
neXtProtiNX_Q15038
OpenTargetsiENSG00000183283
PharmGKBiPA27154

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QTNQ, Eukaryota
GeneTreeiENSGT00390000000685
HOGENOMiCLU_1325998_0_0_1
InParanoidiQ15038
OMAiSVPMAYY
OrthoDBi1175298at2759
PhylomeDBiQ15038
TreeFamiTF329672

Enzyme and pathway databases

PathwayCommonsiQ15038

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9802, 11 hits in 873 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DAZAP2, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DAZAP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9802
PharosiQ15038, Tbio

Protein Ontology

More...
PROi
PR:Q15038
RNActiQ15038, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000183283, Expressed in blood and 245 other tissues
ExpressionAtlasiQ15038, baseline and differential
GenevisibleiQ15038, HS

Family and domain databases

InterProiView protein in InterPro
IPR022730, DAZ_assoc-2
PANTHERiPTHR31638, PTHR31638, 1 hit
PfamiView protein in Pfam
PF11029, DAZAP2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDAZP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15038
Secondary accession number(s): A8K254
, B4DDT5, B4E1G3, C9JA96, C9JP84, E9PB45, F8VU62
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1996
Last modified: August 12, 2020
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again