Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-2

Gene

SEPT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase. Forms a filamentous structure with SEPT12, SEPT6, SEPT2 and probably SEPT4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.1 Publication4 Publications

Miscellaneous

Coordinated expression with SEPT6 and SEPT7.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei78GTPBy similarity1
Binding sitei104GTP; via amide nitrogenBy similarity1
Sitei156Important for dimerization1
Binding sitei241GTP; via amide nitrogen and carbonyl oxygen1
Binding sitei256GTP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi44 – 51GTP8
Nucleotide bindingi183 – 191GTP9

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • GTP binding Source: UniProtKB-KW
  • identical protein binding Source: IntAct

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Differentiation, Mitosis, Spermatogenesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane
SIGNORiQ15019

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-2
Alternative name(s):
Neural precursor cell expressed developmentally down-regulated protein 5
Short name:
NEDD-5
Gene namesi
Name:SEPT2
Synonyms:DIFF6, KIAA0158, NEDD5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000168385.17
HGNCiHGNC:7729 SEPT2
MIMi601506 gene
neXtProtiNX_Q15019

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Centromere, Chromosome, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Kinetochore, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi156F → D: Loss of dimerization. 1 Publication1
Mutagenesisi218S → A: Loss of phosphorylation. 1 Publication1
Mutagenesisi260W → A: Loss of dimerization. 1 Publication1
Mutagenesisi270H → D: Loss of dimerization. 1 Publication1

Organism-specific databases

DisGeNETi4735
OpenTargetsiENSG00000168385
PharmGKBiPA31535

Polymorphism and mutation databases

DMDMi2500769

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001735151 – 361Septin-2Add BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphotyrosineBy similarity1
Modified residuei190N6-acetyllysineCombined sources1
Modified residuei211PhosphotyrosineCombined sources1
Modified residuei218PhosphoserineCombined sources2 Publications1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ15019
MaxQBiQ15019
PaxDbiQ15019
PeptideAtlasiQ15019
PRIDEiQ15019
ProteomicsDBi60368
60369 [Q15019-2]
TopDownProteomicsiQ15019-1 [Q15019-1]

2D gel databases

OGPiQ15019

PTM databases

iPTMnetiQ15019
PhosphoSitePlusiQ15019
SwissPalmiQ15019

Expressioni

Tissue specificityi

Widely expressed. Up-regulated in liver cancer.2 Publications

Gene expression databases

BgeeiENSG00000168385 Expressed in 238 organ(s), highest expression level in metanephros
CleanExiHS_SEPT2
ExpressionAtlasiQ15019 baseline and differential
GenevisibleiQ15019 HS

Organism-specific databases

HPAiCAB017190
HPA018481

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and associate with cellular membranes, actin filaments and microtubules (PubMed:17637674, PubMed:25588830, Ref. 36). GTPase activity is required for filament formation. Filaments are assembled from asymmetrical heterotrimers, composed of SEPT2, SEPT6 and SEPT7 that associate head-to-head to form a hexameric unit (PubMed:16093351, PubMed:16914550). Interaction between SEPT2 and SEPT7 seems indirect. Interacts with SEPT5 (By similarity). Interaction with SEPT4 not detected (By similarity). Interacts with SEPT9 (PubMed:19145258). Component of a septin core octomeric complex consisting of SEPT12, SEPT7, SEPT6 and SEPT2 or SEPT4 in the order 12-7-6-2-2-6-7-12 or 12-7-6-4-4-6-7-12 and located in the sperm annulus (PubMed:16093351, PubMed:16914550). Interacts with MAP4. Interacts with DZIP1L (PubMed:28530676).By similarity7 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110812, 93 interactors
CORUMiQ15019
DIPiDIP-38220N
IntActiQ15019, 33 interactors
MINTiQ15019
STRINGi9606.ENSP00000353157

Structurei

Secondary structure

1361
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ15019
SMRiQ15019
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15019

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 306Septin-type GPROSITE-ProRule annotationAdd BLAST273

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni44 – 51G1 motifPROSITE-ProRule annotation8
Regioni101 – 104G3 motifPROSITE-ProRule annotation4
Regioni182 – 185G4 motifPROSITE-ProRule annotation4
Regioni260 – 270Important for dimerizationAdd BLAST11

Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00910000144020
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ15019
KOiK16942
OMAiQWEQHLI
OrthoDBiEOG091G07TS
PhylomeDBiQ15019
TreeFamiTF101079

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
IPR008113 Septin2
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
PRINTSiPR01740 SEPTIN2
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 19 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15019-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKQQPTQFI NPETPGYVGF ANLPNQVHRK SVKKGFEFTL MVVGESGLGK
60 70 80 90 100
STLINSLFLT DLYPERVIPG AAEKIERTVQ IEASTVEIEE RGVKLRLTVV
110 120 130 140 150
DTPGYGDAIN CRDCFKTIIS YIDEQFERYL HDESGLNRRH IIDNRVHCCF
160 170 180 190 200
YFISPFGHGL KPLDVAFMKA IHNKVNIVPV IAKADTLTLK ERERLKKRIL
210 220 230 240 250
DEIEEHNIKI YHLPDAESDE DEDFKEQTRL LKASIPFSVV GSNQLIEAKG
260 270 280 290 300
KKVRGRLYPW GVVEVENPEH NDFLKLRTML ITHMQDLQEV TQDLHYENFR
310 320 330 340 350
SERLKRGGRK VENEDMNKDQ ILLEKEAELR RMQEMIARMQ AQMQMQMQGG
360
DGDGGALGHH V
Length:361
Mass (Da):41,487
Last modified:November 1, 1997 - v1
Checksum:i12CCBBE30806F92F
GO
Isoform 2 (identifier: Q15019-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPWISEGRATRPCLRVPSARRGDEGLHQRDEASQKM

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):45,461
Checksum:i4BD59305219D99B5
GO
Isoform 3 (identifier: Q15019-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: A → AALNTRKTLLW

Note: No experimental confirmation available.
Show »
Length:371
Mass (Da):42,685
Checksum:i0ED0C05E2DA308B4
GO

Computationally mapped potential isoform sequencesi

There are 19 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCX3B5MCX3_HUMAN
Septin-2
SEPT2
321Annotation score:
C9J2Q4C9J2Q4_HUMAN
Septin-2
SEPT2
184Annotation score:
H7C2Y0H7C2Y0_HUMAN
Septin-2
SEPT2
188Annotation score:
F8WB65F8WB65_HUMAN
Septin-2
SEPT2
80Annotation score:
C9JZI2C9JZI2_HUMAN
Septin-2
SEPT2
105Annotation score:
C9IZU3C9IZU3_HUMAN
Septin-2
SEPT2
131Annotation score:
C9IY94C9IY94_HUMAN
Septin-2
SEPT2
121Annotation score:
C9JB25C9JB25_HUMAN
Septin-2
SEPT2
173Annotation score:
C9JQJ4C9JQJ4_HUMAN
Septin-2
SEPT2
147Annotation score:
H7C310H7C310_HUMAN
Septin-2
SEPT2
161Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAY14718 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAA09928 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti69P → S in AAH14455 (PubMed:15489334).Curated1
Sequence conflicti360 – 361HV → TCKVMCTYKKSEKTLSWIKK KTFQMHDPAVCFQSLGGCHP HFNSTCA in BAA05893 (PubMed:8697812).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0382711M → MPWISEGRATRPCLRVPSAR RGDEGLHQRDEASQKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_05517672A → AALNTRKTLLW in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63878 mRNA Translation: BAA09928.2 Different initiation.
D28540 mRNA Translation: BAA05893.1
AF038404 mRNA Translation: AAB92377.1
AK294563 mRNA Translation: BAG57759.1
AC005104 Genomic DNA No translation available.
AC104841 Genomic DNA Translation: AAY14718.1 Sequence problems.
BC014455 mRNA Translation: AAH14455.1
BC033559 mRNA Translation: AAH33559.1
CCDSiCCDS2548.1 [Q15019-1]
CCDS63195.1 [Q15019-3]
CCDS74682.1 [Q15019-2]
RefSeqiNP_001008491.1, NM_001008491.2 [Q15019-1]
NP_001008492.1, NM_001008492.2 [Q15019-1]
NP_001269901.1, NM_001282972.1 [Q15019-2]
NP_001269902.1, NM_001282973.1 [Q15019-3]
NP_001307958.1, NM_001321029.1
NP_001307959.1, NM_001321030.1 [Q15019-1]
NP_001307960.1, NM_001321031.1 [Q15019-1]
NP_001307961.1, NM_001321032.1 [Q15019-1]
NP_001307962.1, NM_001321033.1 [Q15019-1]
NP_001307963.1, NM_001321034.1 [Q15019-1]
NP_001307964.1, NM_001321035.1 [Q15019-1]
NP_004395.1, NM_004404.4 [Q15019-1]
NP_006146.1, NM_006155.2 [Q15019-1]
XP_016859694.1, XM_017004205.1 [Q15019-1]
XP_016859695.1, XM_017004206.1
UniGeneiHs.721234

Genome annotation databases

EnsembliENST00000360051; ENSP00000353157; ENSG00000168385 [Q15019-1]
ENST00000391971; ENSP00000375832; ENSG00000168385 [Q15019-1]
ENST00000391973; ENSP00000375834; ENSG00000168385 [Q15019-1]
ENST00000401990; ENSP00000385109; ENSG00000168385 [Q15019-3]
ENST00000402092; ENSP00000385172; ENSG00000168385 [Q15019-1]
ENST00000616972; ENSP00000479861; ENSG00000168385 [Q15019-2]
GeneIDi4735
KEGGihsa:4735
UCSCiuc002wbc.5 human [Q15019-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63878 mRNA Translation: BAA09928.2 Different initiation.
D28540 mRNA Translation: BAA05893.1
AF038404 mRNA Translation: AAB92377.1
AK294563 mRNA Translation: BAG57759.1
AC005104 Genomic DNA No translation available.
AC104841 Genomic DNA Translation: AAY14718.1 Sequence problems.
BC014455 mRNA Translation: AAH14455.1
BC033559 mRNA Translation: AAH33559.1
CCDSiCCDS2548.1 [Q15019-1]
CCDS63195.1 [Q15019-3]
CCDS74682.1 [Q15019-2]
RefSeqiNP_001008491.1, NM_001008491.2 [Q15019-1]
NP_001008492.1, NM_001008492.2 [Q15019-1]
NP_001269901.1, NM_001282972.1 [Q15019-2]
NP_001269902.1, NM_001282973.1 [Q15019-3]
NP_001307958.1, NM_001321029.1
NP_001307959.1, NM_001321030.1 [Q15019-1]
NP_001307960.1, NM_001321031.1 [Q15019-1]
NP_001307961.1, NM_001321032.1 [Q15019-1]
NP_001307962.1, NM_001321033.1 [Q15019-1]
NP_001307963.1, NM_001321034.1 [Q15019-1]
NP_001307964.1, NM_001321035.1 [Q15019-1]
NP_004395.1, NM_004404.4 [Q15019-1]
NP_006146.1, NM_006155.2 [Q15019-1]
XP_016859694.1, XM_017004205.1 [Q15019-1]
XP_016859695.1, XM_017004206.1
UniGeneiHs.721234

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QA5X-ray3.40A/B1-315[»]
2QAGX-ray4.00A1-361[»]
2QNRX-ray2.60A/B22-320[»]
ProteinModelPortaliQ15019
SMRiQ15019
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110812, 93 interactors
CORUMiQ15019
DIPiDIP-38220N
IntActiQ15019, 33 interactors
MINTiQ15019
STRINGi9606.ENSP00000353157

PTM databases

iPTMnetiQ15019
PhosphoSitePlusiQ15019
SwissPalmiQ15019

Polymorphism and mutation databases

DMDMi2500769

2D gel databases

OGPiQ15019

Proteomic databases

EPDiQ15019
MaxQBiQ15019
PaxDbiQ15019
PeptideAtlasiQ15019
PRIDEiQ15019
ProteomicsDBi60368
60369 [Q15019-2]
TopDownProteomicsiQ15019-1 [Q15019-1]

Protocols and materials databases

DNASUi4735
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360051; ENSP00000353157; ENSG00000168385 [Q15019-1]
ENST00000391971; ENSP00000375832; ENSG00000168385 [Q15019-1]
ENST00000391973; ENSP00000375834; ENSG00000168385 [Q15019-1]
ENST00000401990; ENSP00000385109; ENSG00000168385 [Q15019-3]
ENST00000402092; ENSP00000385172; ENSG00000168385 [Q15019-1]
ENST00000616972; ENSP00000479861; ENSG00000168385 [Q15019-2]
GeneIDi4735
KEGGihsa:4735
UCSCiuc002wbc.5 human [Q15019-1]

Organism-specific databases

CTDi4735
DisGeNETi4735
EuPathDBiHostDB:ENSG00000168385.17
GeneCardsiSEPT2
HGNCiHGNC:7729 SEPT2
HPAiCAB017190
HPA018481
MIMi601506 gene
neXtProtiNX_Q15019
OpenTargetsiENSG00000168385
PharmGKBiPA31535
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00910000144020
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ15019
KOiK16942
OMAiQWEQHLI
OrthoDBiEOG091G07TS
PhylomeDBiQ15019
TreeFamiTF101079

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane
SIGNORiQ15019

Miscellaneous databases

ChiTaRSiSEPT2 human
EvolutionaryTraceiQ15019
GeneWikiiSEPT2
GenomeRNAii4735
PROiPR:Q15019
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168385 Expressed in 238 organ(s), highest expression level in metanephros
CleanExiHS_SEPT2
ExpressionAtlasiQ15019 baseline and differential
GenevisibleiQ15019 HS

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
IPR008113 Septin2
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
PRINTSiPR01740 SEPTIN2
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSEPT2_HUMAN
AccessioniPrimary (citable) accession number: Q15019
Secondary accession number(s): B4DGE8
, Q14132, Q53QU3, Q8IUK9, Q96CB0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: October 10, 2018
This is version 201 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again