Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15013 (MD2BP_HUMAN)

Entry version 151 (07 Oct 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

MAD2L1-binding protein

Gene

MAD2L1BP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function to silence the spindle checkpoint and allow mitosis to proceed through anaphase by binding MAD2L1 after it has become dissociated from the MAD2L1-CDC20 complex.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q15013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MAD2L1-binding protein
Alternative name(s):
Caught by MAD2 protein
p31(comet)1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAD2L1BP
Synonyms:CMT2, KIAA0110
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000124688.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:21059, MAD2L1BP

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		618136, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15013

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi83Q → A: Loss of interaction with MAD2L1 and disruption of ability to overcome spindle checkpoint-dependent mitotic arrest; when associated with A-191. 1 Publication1
Mutagenesisi191F → A: Loss of interaction with MAD2L1 and disruption of ability to overcome spindle checkpoint-dependent mitotic arrest; when associated with A-83. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9587

Open Targets

More...OpenTargetsi		ENSG00000124688

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134911020

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15013, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MAD2L1BP

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000963101 – 274MAD2L1-binding proteinAdd BLAST274

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei102PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15013

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15013

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15013

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15013

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15013

PeptideAtlas

More...PeptideAtlasi		Q15013

PRoteomics IDEntifications database

More...PRIDEi		Q15013

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19077
60365 [Q15013-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15013

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15013

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During the cell cycle, levels increase and then remain constant until late mitosis after which they drop.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000124688, Expressed in bone marrow and 218 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15013, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000124688, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAD2L1.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114955, 49 interactors

Database of interacting proteins

More...DIPi		DIP-34492N

Protein interaction database and analysis system

More...IntActi		Q15013, 29 interactors

Molecular INTeraction database

More...MINTi		Q15013

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000410818

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q15013, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1274
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15013

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q15013

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni45 – 78Interaction with MAD2L1Add BLAST34

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAD2L1BP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QTUF, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003812

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_079654_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15013

Identification of Orthologs from Complete Genome Data

More...OMAi		PNPSEPF

Database of Orthologous Groups

More...OrthoDBi		1492026at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15013

TreeFam database of animal gene trees

More...TreeFami		TF331730

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009511, MAD1/Cdc20-bound-Mad2-bd

Pfam protein domain database

More...Pfami		View protein in Pfam
PF06581, p31comet, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q15013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPEAEVLS SAAVPDLEWY EKSEETHASQ IELLETSSTQ EPLNASEAFC 
        60         70         80         90        100
PRDCMVPVVF PGPVSQEGCC QFTCELLKHI MYQRQQLPLP YEQLKHFYRK 
       110        120        130        140        150
PSPQAEEMLK KKPRATTEVS SRKCQQALAE LESVLSHLED FFARTLVPRV 
       160        170        180        190        200
LILLGGNALS PKEFYELDLS LLAPYSVDQS LSTAACLRRL FRAIFMADAF 
       210        220        230        240        250
SELQAPPLMG TVVMAQGHRN CGEDWFRPKL NYRVPSRGHK LTVTLSCGRP 
       260        270 
SIRTTAWEDY IWFQAPVTFK GFRE
Length:274
Mass (Da):31,052
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5C49FBE1F456105C
GO
Isoform 2 (identifier: Q15013-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MAAPEAEVLSSAAVP → MARVPLGRSLTLSPRLEHNGMTSAHHNFRLPGSRDSPASASQVAEII

Show »
Length:306
Mass (Da):34,676
Checksum:iBCB9DBD4727B49A9
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG59665 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti133S → G in BAG59665 (PubMed:14702039).Curated1
Sequence conflicti274E → D in CAG33174 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0462681 – 15MAAPE…SAAVP → MARVPLGRSLTLSPRLEHNG MTSAHHNFRLPGSRDSPASA SQVAEII in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D14811 mRNA Translation: BAA03552.1
AK297172 mRNA Translation: BAG59665.1 Different initiation.
CR456893 mRNA Translation: CAG33174.1
AL136131 Genomic DNA No translation available.
AL353602 Genomic DNA No translation available.
BC002904 mRNA Translation: AAH02904.1
AL537692 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47431.1 [Q15013-3]
CCDS4904.1 [Q15013-1]

NCBI Reference Sequences

More...RefSeqi		NP_001003690.1, NM_001003690.1 [Q15013-3]
NP_055443.1, NM_014628.2 [Q15013-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000372171; ENSP00000361244; ENSG00000124688 [Q15013-1]
ENST00000451025; ENSP00000410818; ENSG00000124688 [Q15013-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9587

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9587

UCSC genome browser

More...UCSCi		uc003ovu.4, human [Q15013-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14811 mRNA Translation: BAA03552.1
AK297172 mRNA Translation: BAG59665.1 Different initiation.
CR456893 mRNA Translation: CAG33174.1
AL136131 Genomic DNA No translation available.
AL353602 Genomic DNA No translation available.
BC002904 mRNA Translation: AAH02904.1
AL537692 mRNA No translation available.
CCDSiCCDS47431.1 [Q15013-3]
CCDS4904.1 [Q15013-1]
RefSeqiNP_001003690.1, NM_001003690.1 [Q15013-3]
NP_055443.1, NM_014628.2 [Q15013-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QYFX-ray2.30B/D36-274[»]
6F0Xelectron microscopy4.60P1-274[»]
SMRiQ15013
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114955, 49 interactors
DIPiDIP-34492N
IntActiQ15013, 29 interactors
MINTiQ15013
STRINGi9606.ENSP00000410818

PTM databases

iPTMnetiQ15013
PhosphoSitePlusiQ15013

Polymorphism and mutation databases

BioMutaiMAD2L1BP

Proteomic databases

EPDiQ15013
jPOSTiQ15013
MassIVEiQ15013
MaxQBiQ15013
PaxDbiQ15013
PeptideAtlasiQ15013
PRIDEiQ15013
ProteomicsDBi19077
60365 [Q15013-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30554, 289 antibodies

The DNASU plasmid repository

More...DNASUi		9587

Genome annotation databases

EnsembliENST00000372171; ENSP00000361244; ENSG00000124688 [Q15013-1]
ENST00000451025; ENSP00000410818; ENSG00000124688 [Q15013-3]
GeneIDi9587
KEGGihsa:9587
UCSCiuc003ovu.4, human [Q15013-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9587
DisGeNETi9587
EuPathDBiHostDB:ENSG00000124688.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		MAD2L1BP
HGNCiHGNC:21059, MAD2L1BP
HPAiENSG00000124688, Low tissue specificity
MIMi618136, gene
neXtProtiNX_Q15013
OpenTargetsiENSG00000124688
PharmGKBiPA134911020

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QTUF, Eukaryota
GeneTreeiENSGT00390000003812
HOGENOMiCLU_079654_0_0_1
InParanoidiQ15013
OMAiPNPSEPF
OrthoDBi1492026at2759
PhylomeDBiQ15013
TreeFamiTF331730

Enzyme and pathway databases

PathwayCommonsiQ15013

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9587, 211 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MAD2L1BP, human
EvolutionaryTraceiQ15013

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MAD2L1BP

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9587
PharosiQ15013, Tbio

Protein Ontology

More...PROi		PR:Q15013
RNActiQ15013, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000124688, Expressed in bone marrow and 218 other tissues
GenevisibleiQ15013, HS

Family and domain databases

InterProiView protein in InterPro
IPR009511, MAD1/Cdc20-bound-Mad2-bd
PfamiView protein in Pfam
PF06581, p31comet, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMD2BP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15013
Secondary accession number(s): B4DLV3, E9PAT7, Q6IBB1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: October 7, 2020
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again