Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q15008 (PSMD6_HUMAN)

Entry version 188 (18 Sep 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

26S proteasome non-ATPase regulatory subunit 6

Gene

PSMD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1169091 Activation of NF-kappaB in B cells
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-1236974 ER-Phagosome pathway
R-HSA-1236978 Cross-presentation of soluble exogenous antigens (endosomes)
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174113 SCF-beta-TrCP mediated degradation of Emi1
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-180534 Vpu mediated degradation of CD4
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-187577 SCF(Skp2)-mediated degradation of p27/p21
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-202424 Downstream TCR signaling
R-HSA-211733 Regulation of activated PAK-2p34 by proteasome mediated degradation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-349425 Autodegradation of the E3 ubiquitin ligase COP1
R-HSA-350562 Regulation of ornithine decarboxylase (ODC)
R-HSA-382556 ABC-family proteins mediated transport
R-HSA-450408 AUF1 (hnRNP D0) binds and destabilizes mRNA
R-HSA-4608870 Asymmetric localization of PCP proteins
R-HSA-4641257 Degradation of AXIN
R-HSA-4641258 Degradation of DVL
R-HSA-5358346 Hedgehog ligand biogenesis
R-HSA-5362768 Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
R-HSA-5607761 Dectin-1 mediated noncanonical NF-kB signaling
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-5610780 Degradation of GLI1 by the proteasome
R-HSA-5610783 Degradation of GLI2 by the proteasome
R-HSA-5610785 GLI3 is processed to GLI3R by the proteasome
R-HSA-5632684 Hedgehog 'on' state
R-HSA-5658442 Regulation of RAS by GAPs
R-HSA-5668541 TNFR2 non-canonical NF-kB pathway
R-HSA-5676590 NIK-->noncanonical NF-kB signaling
R-HSA-5678895 Defective CFTR causes cystic fibrosis
R-HSA-5687128 MAPK6/MAPK4 signaling
R-HSA-5689603 UCH proteinases
R-HSA-5689880 Ub-specific processing proteases
R-HSA-6798695 Neutrophil degranulation
R-HSA-68827 CDT1 association with the CDC6:ORC:origin complex
R-HSA-68949 Orc1 removal from chromatin
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-69481 G2/M Checkpoints
R-HSA-69601 Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
R-HSA-75815 Ubiquitin-dependent degradation of Cyclin D
R-HSA-8852276 The role of GTSE1 in G2/M progression after G2 checkpoint
R-HSA-8854050 FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
R-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-HSA-8939902 Regulation of RUNX2 expression and activity
R-HSA-8941858 Regulation of RUNX3 expression and activity
R-HSA-8948751 Regulation of PTEN stability and activity
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9020702 Interleukin-1 signaling
R-HSA-9604323 Negative regulation of NOTCH4 signaling
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
26S proteasome non-ATPase regulatory subunit 6
Alternative name(s):
26S proteasome regulatory subunit RPN7
26S proteasome regulatory subunit S10
Breast cancer-associated protein SGA-113M
Phosphonoformate immuno-associated protein 4
Proteasome regulatory particle subunit p44S10
p42A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PSMD6
Synonyms:KIAA0107, PFAAP4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9564 PSMD6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		617857 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q15008

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Proteasome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9861

Open Targets

More...OpenTargetsi		ENSG00000163636

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33910

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q15008

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2364701

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PSMD6

Domain mapping of disease mutations (DMDM)

More...DMDMi		2494625

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001738382 – 38926S proteasome non-ATPase regulatory subunit 6Add BLAST388

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q15008

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q15008

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q15008

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q15008

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q15008

PeptideAtlas

More...PeptideAtlasi		Q15008

PRoteomics IDEntifications database

More...PRIDEi		Q15008

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20548
60360 [Q15008-1]
67429

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q15008-1 [Q15008-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q15008

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q15008

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q15008

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163636 Expressed in 231 organ(s), highest expression level in body of pancreas

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q15008 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q15008 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA036921
HPA036922

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP). The regulatory particle is made of a lid composed of 9 subunits including PSMD6, a base containing 6 ATPases and few additional components.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115195, 147 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q15008

Database of interacting proteins

More...DIPi		DIP-27590N

Protein interaction database and analysis system

More...IntActi		Q15008, 57 interactors

Molecular INTeraction database

More...MINTi		Q15008

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q15008

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini193 – 361PCIPROSITE-ProRule annotationAdd BLAST169

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the proteasome subunit S10 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0687 Eukaryota
COG5187 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00510000046608

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000214998

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q15008

KEGG Orthology (KO)

More...KOi		K03037

Identification of Orthologs from Complete Genome Data

More...OMAi		VDYIDQE

Database of Orthologous Groups

More...OrthoDBi		1194691at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q15008

TreeFam database of animal gene trees

More...TreeFami		TF313819

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000717 PCI_dom
IPR035268 PSMD6
IPR019585 Rpn7/CSN1
IPR011990 TPR-like_helical_dom_sf
IPR036390 WH_DNA-bd_sf

The PANTHER Classification System

More...PANTHERi		PTHR14145:SF1 PTHR14145:SF1, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01399 PCI, 1 hit
PF10602 RPN7, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00088 PINT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46785 SSF46785, 1 hit
SSF48452 SSF48452, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50250 PCI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q15008-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLENLEEEG LPKNPDLRIA QLRFLLSLPE HRGDAAVRDE LMAAVRDNNM 
        60         70         80         90        100
APYYEALCKS LDWQIDVDLL NKMKKANEDE LKRLDEELED AEKNLGESEI 
       110        120        130        140        150
RDAMMAKAEY LCRIGDKEGA LTAFRKTYDK TVALGHRLDI VFYLLRIGLF 
       160        170        180        190        200
YMDNDLITRN TEKAKSLIEE GGDWDRRNRL KVYQGLYCVA IRDFKQAAEL 
       210        220        230        240        250
FLDTVSTFTS YELMDYKTFV TYTVYVSMIA LERPDLREKV IKGAEILEVL 
       260        270        280        290        300
HSLPAVRQYL FSLYECRYSV FFQSLAVVEQ EMKKDWLFAP HYRYYVREMR 
       310        320        330        340        350
IHAYSQLLES YRSLTLGYMA EAFGVGVEFI DQELSRFIAA GRLHCKIDKV 
       360        370        380 
NEIVETNRPD SKNWQYQETI KKGDLLLNRV QKLSRVINM
Length:389
Mass (Da):45,531
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8843E6684AE91ACD
GO
Isoform 2 (identifier: Q15008-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → MNESNDSTNYD

Show »
Length:351
Mass (Da):41,252
Checksum:i16264993C10CA139
GO
Isoform 3 (identifier: Q15008-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-49: GLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → D

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:350
Mass (Da):41,181
Checksum:i539D0FE51F09DE49
GO
Isoform 4 (identifier: Q15008-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: N → NFWNRIRQEQTEDCPPSSPSRGWHCQDWPSRKPPTSIRLCFAKPIIKRHRMPSY

Note: No experimental confirmation available.
Show »
Length:442
Mass (Da):51,923
Checksum:i1E60106CE872DF9F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J0E9C9J0E9_HUMAN
26S proteasome non-ATPase regulator...
PSMD6
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7B7C9J7B7_HUMAN
26S proteasome non-ATPase regulator...
PSMD6
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C531H7C531_HUMAN
26S proteasome non-ATPase regulator...
PSMD6
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0477111 – 49MPLEN…VRDNN → MNESNDSTNYD in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_05517710 – 49GLPKN…VRDNN → D in isoform 3. CuratedAdd BLAST40
Alternative sequenceiVSP_05517849N → NFWNRIRQEQTEDCPPSSPS RGWHCQDWPSRKPPTSIRLC FAKPIIKRHRMPSY in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF215935 mRNA Translation: AAF65540.1
AF530062 mRNA Translation: AAQ09946.1
AY359879 mRNA Translation: AAQ63402.1
AY568086 mRNA Translation: AAS68366.1
D14663 mRNA Translation: BAA03497.1
BX647742 mRNA No translation available.
AK290205 mRNA Translation: BAF82894.1
AC012557 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW65424.1
CH471055 Genomic DNA Translation: EAW65427.1
BC000630 mRNA Translation: AAH00630.1
BC000904 mRNA Translation: AAH00904.1
BC012369 mRNA Translation: AAH12369.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2901.1 [Q15008-1]
CCDS63677.1 [Q15008-4]
CCDS63678.1 [Q15008-3]
CCDS63679.1 [Q15008-2]

NCBI Reference Sequences

More...RefSeqi		NP_001258708.1, NM_001271779.1 [Q15008-4]
NP_001258709.1, NM_001271780.1 [Q15008-2]
NP_001258710.1, NM_001271781.1 [Q15008-3]
NP_055629.1, NM_014814.2 [Q15008-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000295901; ENSP00000295901; ENSG00000163636 [Q15008-1]
ENST00000394431; ENSP00000377952; ENSG00000163636 [Q15008-2]
ENST00000482510; ENSP00000419227; ENSG00000163636 [Q15008-3]
ENST00000492933; ENSP00000418695; ENSG00000163636 [Q15008-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9861

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9861

UCSC genome browser

More...UCSCi		uc003dma.3 human [Q15008-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF215935 mRNA Translation: AAF65540.1
AF530062 mRNA Translation: AAQ09946.1
AY359879 mRNA Translation: AAQ63402.1
AY568086 mRNA Translation: AAS68366.1
D14663 mRNA Translation: BAA03497.1
BX647742 mRNA No translation available.
AK290205 mRNA Translation: BAF82894.1
AC012557 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW65424.1
CH471055 Genomic DNA Translation: EAW65427.1
BC000630 mRNA Translation: AAH00630.1
BC000904 mRNA Translation: AAH00904.1
BC012369 mRNA Translation: AAH12369.1
CCDSiCCDS2901.1 [Q15008-1]
CCDS63677.1 [Q15008-4]
CCDS63678.1 [Q15008-3]
CCDS63679.1 [Q15008-2]
RefSeqiNP_001258708.1, NM_001271779.1 [Q15008-4]
NP_001258709.1, NM_001271780.1 [Q15008-2]
NP_001258710.1, NM_001271781.1 [Q15008-3]
NP_055629.1, NM_014814.2 [Q15008-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5GJQelectron microscopy4.50R1-389[»]
5GJRelectron microscopy3.505/R1-389[»]
5L4Kelectron microscopy4.50R1-389[»]
5LN3electron microscopy6.80R1-389[»]
5M32electron microscopy3.80m1-389[»]
5T0Celectron microscopy3.80AY/BY1-389[»]
5T0Gelectron microscopy4.40Y1-389[»]
5T0Helectron microscopy6.80Y1-389[»]
5T0Ielectron microscopy8.00Y1-389[»]
5T0Jelectron microscopy8.00Y1-389[»]
5VFPelectron microscopy4.20Y12-389[»]
5VFQelectron microscopy4.20Y12-389[»]
5VFRelectron microscopy4.90Y12-389[»]
5VFSelectron microscopy3.60Y12-389[»]
5VFTelectron microscopy7.00Y12-389[»]
5VFUelectron microscopy5.80Y12-389[»]
5VGZelectron microscopy3.70Y12-389[»]
5VHFelectron microscopy5.70Y12-389[»]
5VHHelectron microscopy6.10Y12-389[»]
5VHIelectron microscopy6.80Y12-389[»]
5VHSelectron microscopy8.80Y12-389[»]
6MSBelectron microscopy3.00Y1-389[»]
6MSDelectron microscopy3.20Y1-389[»]
6MSGelectron microscopy3.50Y1-389[»]
6MSHelectron microscopy3.60Y1-389[»]
6MSJelectron microscopy3.30Y1-389[»]
6MSKelectron microscopy3.20Y1-389[»]
SMRiQ15008
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115195, 147 interactors
CORUMiQ15008
DIPiDIP-27590N
IntActiQ15008, 57 interactors
MINTiQ15008

Chemistry databases

ChEMBLiCHEMBL2364701

PTM databases

iPTMnetiQ15008
PhosphoSitePlusiQ15008
SwissPalmiQ15008

Polymorphism and mutation databases

BioMutaiPSMD6
DMDMi2494625

Proteomic databases

EPDiQ15008
jPOSTiQ15008
MassIVEiQ15008
MaxQBiQ15008
PaxDbiQ15008
PeptideAtlasiQ15008
PRIDEiQ15008
ProteomicsDBi20548
60360 [Q15008-1]
67429
TopDownProteomicsiQ15008-1 [Q15008-1]

Genome annotation databases

EnsembliENST00000295901; ENSP00000295901; ENSG00000163636 [Q15008-1]
ENST00000394431; ENSP00000377952; ENSG00000163636 [Q15008-2]
ENST00000482510; ENSP00000419227; ENSG00000163636 [Q15008-3]
ENST00000492933; ENSP00000418695; ENSG00000163636 [Q15008-4]
GeneIDi9861
KEGGihsa:9861
UCSCiuc003dma.3 human [Q15008-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9861
DisGeNETi9861

GeneCards: human genes, protein and diseases

More...GeneCardsi		PSMD6
HGNCiHGNC:9564 PSMD6
HPAiHPA036921
HPA036922
MIMi617857 gene
neXtProtiNX_Q15008
OpenTargetsiENSG00000163636
PharmGKBiPA33910

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0687 Eukaryota
COG5187 LUCA
GeneTreeiENSGT00510000046608
HOGENOMiHOG000214998
InParanoidiQ15008
KOiK03037
OMAiVDYIDQE
OrthoDBi1194691at2759
PhylomeDBiQ15008
TreeFamiTF313819

Enzyme and pathway databases

ReactomeiR-HSA-1169091 Activation of NF-kappaB in B cells
R-HSA-1234176 Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
R-HSA-1236974 ER-Phagosome pathway
R-HSA-1236978 Cross-presentation of soluble exogenous antigens (endosomes)
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174113 SCF-beta-TrCP mediated degradation of Emi1
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-180534 Vpu mediated degradation of CD4
R-HSA-180585 Vif-mediated degradation of APOBEC3G
R-HSA-187577 SCF(Skp2)-mediated degradation of p27/p21
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-202424 Downstream TCR signaling
R-HSA-211733 Regulation of activated PAK-2p34 by proteasome mediated degradation
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2871837 FCERI mediated NF-kB activation
R-HSA-349425 Autodegradation of the E3 ubiquitin ligase COP1
R-HSA-350562 Regulation of ornithine decarboxylase (ODC)
R-HSA-382556 ABC-family proteins mediated transport
R-HSA-450408 AUF1 (hnRNP D0) binds and destabilizes mRNA
R-HSA-4608870 Asymmetric localization of PCP proteins
R-HSA-4641257 Degradation of AXIN
R-HSA-4641258 Degradation of DVL
R-HSA-5358346 Hedgehog ligand biogenesis
R-HSA-5362768 Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
R-HSA-5607761 Dectin-1 mediated noncanonical NF-kB signaling
R-HSA-5607764 CLEC7A (Dectin-1) signaling
R-HSA-5610780 Degradation of GLI1 by the proteasome
R-HSA-5610783 Degradation of GLI2 by the proteasome
R-HSA-5610785 GLI3 is processed to GLI3R by the proteasome
R-HSA-5632684 Hedgehog 'on' state
R-HSA-5658442 Regulation of RAS by GAPs
R-HSA-5668541 TNFR2 non-canonical NF-kB pathway
R-HSA-5676590 NIK-->noncanonical NF-kB signaling
R-HSA-5678895 Defective CFTR causes cystic fibrosis
R-HSA-5687128 MAPK6/MAPK4 signaling
R-HSA-5689603 UCH proteinases
R-HSA-5689880 Ub-specific processing proteases
R-HSA-6798695 Neutrophil degranulation
R-HSA-68827 CDT1 association with the CDC6:ORC:origin complex
R-HSA-68949 Orc1 removal from chromatin
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-69481 G2/M Checkpoints
R-HSA-69601 Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
R-HSA-75815 Ubiquitin-dependent degradation of Cyclin D
R-HSA-8852276 The role of GTSE1 in G2/M progression after G2 checkpoint
R-HSA-8854050 FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
R-HSA-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-HSA-8939902 Regulation of RUNX2 expression and activity
R-HSA-8941858 Regulation of RUNX3 expression and activity
R-HSA-8948751 Regulation of PTEN stability and activity
R-HSA-8951664 Neddylation
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9020702 Interleukin-1 signaling
R-HSA-9604323 Negative regulation of NOTCH4 signaling
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PSMD6 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PSMD6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9861
PharosiQ15008

Protein Ontology

More...PROi		PR:Q15008

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000163636 Expressed in 231 organ(s), highest expression level in body of pancreas
ExpressionAtlasiQ15008 baseline and differential
GenevisibleiQ15008 HS

Family and domain databases

InterProiView protein in InterPro
IPR000717 PCI_dom
IPR035268 PSMD6
IPR019585 Rpn7/CSN1
IPR011990 TPR-like_helical_dom_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR14145:SF1 PTHR14145:SF1, 1 hit
PfamiView protein in Pfam
PF01399 PCI, 1 hit
PF10602 RPN7, 1 hit
SMARTiView protein in SMART
SM00088 PINT, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50250 PCI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPSMD6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q15008
Secondary accession number(s): A8K2E0, E9PHI9, Q6UV22
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: September 18, 2019
This is version 188 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again