Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (11 Dec 2019)
Sequence version 2 (22 Jul 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-activated chloride channel regulator 4

Gene

CLCA4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in mediating calcium-activated chloride conductance.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi155Zinc; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei156By similarity1
Metal bindingi159Zinc; catalyticBy similarity1
Metal bindingi166Zinc; catalyticBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processTransport
LigandChloride, Metal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M87.002

Transport Classification Database

More...
TCDBi
1.A.13.1.2 the epithelial chloride channel (e-clc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-activated chloride channel regulator 4 (EC:3.4.-.-By similarity)
Alternative name(s):
Calcium-activated chloride channel family member 4
Short name:
hCLCA4
Calcium-activated chloride channel protein 2
Short name:
CaCC-2
Short name:
hCaCC-2
Chloride channel accessory 4
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLCA4
Synonyms:CaCC2
ORF Names:UNQ562/PRO1124
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000016602.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2018 CLCA4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616857 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14CN2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei895 – 915HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22802

MalaCards human disease database

More...
MalaCardsi
CLCA4

Open Targets

More...
OpenTargetsi
ENSG00000016602

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
586 Cystic fibrosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26545

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14CN2 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2364708

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLCA4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205831469

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000034538922 – 919Calcium-activated chloride channel regulator 4Add BLAST898
ChainiPRO_000034539022 – ?Calcium-activated chloride channel regulator 4, 110 kDa form
ChainiPRO_0000345391? – 919Calcium-activated chloride channel regulator 4, 30 kDa form

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi75N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi340N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi504N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi542N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi588N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi628N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi811N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi832N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi837N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi852N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The translation product is autoproteolytically cleaved by the metalloprotease domain in the endoplasmic reticulum into a N-terminal and a C-terminal products that remain physically associated with each other. The cleavage is necessary for calcium-activated chloride channel (CaCC) activation activity.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei697 – 698Cleavage; by autolysisBy similarity2

Keywords - PTMi

Autocatalytic cleavage, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14CN2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14CN2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14CN2

PeptideAtlas

More...
PeptideAtlasi
Q14CN2

PRoteomics IDEntifications database

More...
PRIDEi
Q14CN2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
1948
60328 [Q14CN2-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14CN2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14CN2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Primarily expressed in the digestive tract, mainly in colon. Detected in smaller amounts in brain, urogenital organs, testis, and salivary and mammary glands. Highly expressed in the epithelial layer and submucosal gland of the inferior turbinate mucosa. Lower levels in the epithelial layer of nasal polyp.3 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in oral tongue squamous cell carcinomas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000016602 Expressed in 132 organ(s), highest expression level in colonic mucosa

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14CN2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA017045
HPA064770

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116482, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q14CN2, 1 interactor

Molecular INTeraction database

More...
MINTi
Q14CN2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359594

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q14CN2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14CN2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini306 – 476VWFAPROSITE-ProRule annotationAdd BLAST171

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni45 – 199Metalloprotease domainBy similarityAdd BLAST155

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The metalloprotease region is responsible for autoproteolytic processing. It can also cross-cleave other CLCA substrates.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CLCR family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEPS Eukaryota
ENOG410XPSZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160416

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015107

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14CN2

KEGG Orthology (KO)

More...
KOi
K05030

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVGTWAY

Database of Orthologous Groups

More...
OrthoDBi
853728at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14CN2

TreeFam database of animal gene trees

More...
TreeFami
TF328396

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.410, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004727 CLCA_chordata
IPR013642 CLCA_N
IPR002035 VWF_A
IPR036465 vWFA_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08434 CLCA, 1 hit
PF00092 VWA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00327 VWA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53300 SSF53300, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00868 hCaCC, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50234 VWFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q14CN2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLFRGFVFL LVLCLLHQSN TSFIKLNNNG FEDIVIVIDP SVPEDEKIIE
60 70 80 90 100
QIEDMVTTAS TYLFEATEKR FFFKNVSILI PENWKENPQY KRPKHENHKH
110 120 130 140 150
ADVIVAPPTL PGRDEPYTKQ FTECGEKGEY IHFTPDLLLG KKQNEYGPPG
160 170 180 190 200
KLFVHEWAHL RWGVFDEYNE DQPFYRAKSK KIEATRCSAG ISGRNRVYKC
210 220 230 240 250
QGGSCLSRAC RIDSTTKLYG KDCQFFPDKV QTEKASIMFM QSIDSVVEFC
260 270 280 290 300
NEKTHNQEAP SLQNIKCNFR STWEVISNSE DFKNTIPMVT PPPPPVFSLL
310 320 330 340 350
KISQRIVCLV LDKSGSMGGK DRLNRMNQAA KHFLLQTVEN GSWVGMVHFD
360 370 380 390 400
STATIVNKLI QIKSSDERNT LMAGLPTYPL GGTSICSGIK YAFQVIGELH
410 420 430 440 450
SQLDGSEVLL LTDGEDNTAS SCIDEVKQSG AIVHFIALGR AADEAVIEMS
460 470 480 490 500
KITGGSHFYV SDEAQNNGLI DAFGALTSGN TDLSQKSLQL ESKGLTLNSN
510 520 530 540 550
AWMNDTVIID STVGKDTFFL ITWNSLPPSI SLWDPSGTIM ENFTVDATSK
560 570 580 590 600
MAYLSIPGTA KVGTWAYNLQ AKANPETLTI TVTSRAANSS VPPITVNAKM
610 620 630 640 650
NKDVNSFPSP MIVYAEILQG YVPVLGANVT AFIESQNGHT EVLELLDNGA
660 670 680 690 700
GADSFKNDGV YSRYFTAYTE NGRYSLKVRA HGGANTARLK LRPPLNRAAY
710 720 730 740 750
IPGWVVNGEI EANPPRPEID EDTQTTLEDF SRTASGGAFV VSQVPSLPLP
760 770 780 790 800
DQYPPSQITD LDATVHEDKI ILTWTAPGDN FDVGKVQRYI IRISASILDL
810 820 830 840 850
RDSFDDALQV NTTDLSPKEA NSKESFAFKP ENISEENATH IFIAIKSIDK
860 870 880 890 900
SNLTSKVSNI AQVTLFIPQA NPDDIDPTPT PTPTPTPDKS HNSGVNISTL
910
VLSVIGSVVI VNFILSTTI
Length:919
Mass (Da):101,283
Last modified:July 22, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i47C0DF125A319810
GO
Isoform 2 (identifier: Q14CN2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-287: Missing.
     490-524: LESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWN → VRVLIPWVFMFTFATRKNHLVVISFEFHIFLKVNF
     525-919: Missing.

Show »
Length:237
Mass (Da):25,849
Checksum:i0B3A1F1D60877BA6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti303S → R in AAD48398 (PubMed:10437792).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04581643P → S. Corresponds to variant dbSNP:rs2231580Ensembl.1
Natural variantiVAR_045817443D → V. Corresponds to variant dbSNP:rs2839932Ensembl.1
Natural variantiVAR_045818449M → L. Corresponds to variant dbSNP:rs1011048Ensembl.1
Natural variantiVAR_045819810V → L1 PublicationCorresponds to variant dbSNP:rs2231604Ensembl.1
Natural variantiVAR_045820877 – 878Missing 2 Publications2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0561171 – 287Missing in isoform 2. 1 PublicationAdd BLAST287
Alternative sequenceiVSP_056118490 – 524LESKG…LITWN → VRVLIPWVFMFTFATRKNHL VVISFEFHIFLKVNF in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_056119525 – 919Missing in isoform 2. 1 PublicationAdd BLAST395

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF127035 mRNA Translation: AAD48398.1
AY358470 mRNA Translation: AAQ88834.1
AK293766 mRNA Translation: BAH11591.1
AL122002 Genomic DNA No translation available.
BC113687 mRNA Translation: AAI13688.1
BC113689 mRNA Translation: AAI13690.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41355.1 [Q14CN2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_036260.2, NM_012128.3 [Q14CN2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370563; ENSP00000359594; ENSG00000016602 [Q14CN2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22802

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22802

UCSC genome browser

More...
UCSCi
uc009wcs.4 human [Q14CN2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF127035 mRNA Translation: AAD48398.1
AY358470 mRNA Translation: AAQ88834.1
AK293766 mRNA Translation: BAH11591.1
AL122002 Genomic DNA No translation available.
BC113687 mRNA Translation: AAI13688.1
BC113689 mRNA Translation: AAI13690.1
CCDSiCCDS41355.1 [Q14CN2-1]
RefSeqiNP_036260.2, NM_012128.3 [Q14CN2-1]

3D structure databases

SMRiQ14CN2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116482, 1 interactor
IntActiQ14CN2, 1 interactor
MINTiQ14CN2
STRINGi9606.ENSP00000359594

Chemistry databases

ChEMBLiCHEMBL2364708

Protein family/group databases

MEROPSiM87.002
TCDBi1.A.13.1.2 the epithelial chloride channel (e-clc) family

PTM databases

iPTMnetiQ14CN2
PhosphoSitePlusiQ14CN2

Polymorphism and mutation databases

BioMutaiCLCA4
DMDMi205831469

Proteomic databases

jPOSTiQ14CN2
MassIVEiQ14CN2
PaxDbiQ14CN2
PeptideAtlasiQ14CN2
PRIDEiQ14CN2
ProteomicsDBi1948
60328 [Q14CN2-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22802

Genome annotation databases

EnsembliENST00000370563; ENSP00000359594; ENSG00000016602 [Q14CN2-1]
GeneIDi22802
KEGGihsa:22802
UCSCiuc009wcs.4 human [Q14CN2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22802
DisGeNETi22802
EuPathDBiHostDB:ENSG00000016602.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLCA4
HGNCiHGNC:2018 CLCA4
HPAiHPA017045
HPA064770
MalaCardsiCLCA4
MIMi616857 gene
neXtProtiNX_Q14CN2
OpenTargetsiENSG00000016602
Orphaneti586 Cystic fibrosis
PharmGKBiPA26545

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEPS Eukaryota
ENOG410XPSZ LUCA
GeneTreeiENSGT00940000160416
HOGENOMiHOG000015107
InParanoidiQ14CN2
KOiK05030
OMAiKVGTWAY
OrthoDBi853728at2759
PhylomeDBiQ14CN2
TreeFamiTF328396

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLCA4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CLCA4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22802
PharosiQ14CN2 Tbio

Protein Ontology

More...
PROi
PR:Q14CN2
RNActiQ14CN2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000016602 Expressed in 132 organ(s), highest expression level in colonic mucosa
GenevisibleiQ14CN2 HS

Family and domain databases

Gene3Di3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR004727 CLCA_chordata
IPR013642 CLCA_N
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF08434 CLCA, 1 hit
PF00092 VWA, 1 hit
SMARTiView protein in SMART
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
TIGRFAMsiTIGR00868 hCaCC, 1 hit
PROSITEiView protein in PROSITE
PS50234 VWFA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLCA4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14CN2
Secondary accession number(s): A8MQC9
, B7Z1Q5, Q6UX81, Q9UNF7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: December 11, 2019
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again