Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (08 May 2019)
Sequence version 1 (22 Aug 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sarcolemmal membrane-associated protein

Gene

SLMAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role during myoblast fusion.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sarcolemmal membrane-associated protein
Short name:
Sarcolemmal-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLMAP
Synonyms:KIAA1601, SLAP
ORF Names:UNQ1847/PRO3577
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16643 SLMAP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602701 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14BN4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 802CytoplasmicSequence analysisAdd BLAST802
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei803 – 823Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini824 – 828ExtracellularSequence analysis5

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7871

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
SLMAP

MalaCards human disease database

More...
MalaCardsi
SLMAP

Open Targets

More...
OpenTargetsi
ENSG00000163681

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
130 Brugada syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38179

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLMAP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
118597508

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002596621 – 828Sarcolemmal membrane-associated proteinAdd BLAST828

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei148PhosphoserineCombined sources1
Modified residuei448PhosphoserineBy similarity1
Modified residuei452PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14BN4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14BN4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14BN4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14BN4

PeptideAtlas

More...
PeptideAtlasi
Q14BN4

PRoteomics IDEntifications database

More...
PRIDEi
Q14BN4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60298
60299 [Q14BN4-2]
60300 [Q14BN4-3]
60301 [Q14BN4-4]
60302 [Q14BN4-5]
60303 [Q14BN4-6]
60304 [Q14BN4-7]
60305 [Q14BN4-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14BN4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14BN4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163681 Expressed in 203 organ(s), highest expression level in myometrium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14BN4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14BN4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA002357
HPA002358

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with myosin (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113620, 70 interactors

Protein interaction database and analysis system

More...
IntActi
Q14BN4, 51 interactors

Molecular INTeraction database

More...
MINTi
Q14BN4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000295951

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1828
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14BN4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 85FHAPROSITE-ProRule annotationAdd BLAST58

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 163Necessary for targeting to centrosomesBy similarityAdd BLAST163

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili167 – 202Sequence analysisAdd BLAST36
Coiled coili230 – 388Sequence analysisAdd BLAST159
Coiled coili477 – 799Sequence analysisAdd BLAST323

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SLMAP family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3872 Eukaryota
COG1716 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157660

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14BN4

Identification of Orthologs from Complete Genome Data

More...
OMAi
TKQEIQH

Database of Orthologous Groups

More...
OrthoDBi
664798at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14BN4

TreeFam database of animal gene trees

More...
TreeFami
TF318787

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253 FHA_dom
IPR030498 SLMAP
IPR008984 SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR15715:SF22 PTHR15715:SF22, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00498 FHA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14BN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV
60 70 80 90 100
LSRNHALVWF DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG
110 120 130 140 150
DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV
160 170 180 190 200
DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS
210 220 230 240 250
DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHNY
260 270 280 290 300
ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL
310 320 330 340 350
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME
360 370 380 390 400
EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS
410 420 430 440 450
KSGGDCTFIH QFIECQKKLI VEGHLTKAVE ETKLSKENQT RAKESDFSDT
460 470 480 490 500
LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS LLKDDLQGAQ SEIEAKQEIQ
510 520 530 540 550
HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE STKQIQVLQA
560 570 580 590 600
QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT
610 620 630 640 650
DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE
660 670 680 690 700
EATRLQGELE KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ
710 720 730 740 750
SLELTSDLSI LQMSRKELEN QVGSLKEQHL RDSADLKTLL SKAENQAKDV
760 770 780 790 800
QKEYEKTQTV LSELKLKFEM TEQEKQSITD ELKQCKNNLK LLREKGNNKP
810 820
WPWMPMLAAL VAVTAIVLYV PGLARASP
Length:828
Mass (Da):95,198
Last modified:August 22, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i20F5FA38174CA383
GO
Isoform 2 (identifier: Q14BN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E

Show »
Length:790
Mass (Da):90,829
Checksum:i2A5F92ECEF240518
GO
Isoform 3 (identifier: Q14BN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-395: Missing.

Note: Incomplete sequence.
Show »
Length:811
Mass (Da):93,203
Checksum:i17BCE2C5B6243F6C
GO
Isoform 4 (identifier: Q14BN4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     379-436: Missing.
     798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK

Show »
Length:452
Mass (Da):52,228
Checksum:i28B281416FD23FCD
GO
Isoform 5 (identifier: Q14BN4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:359
Mass (Da):41,896
Checksum:iDAEFBF630F5C6443
GO
Isoform 6 (identifier: Q14BN4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
     484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
     511-828: Missing.

Show »
Length:506
Mass (Da):57,531
Checksum:i2A77ABF7E61C8418
GO
Isoform 7 (identifier: Q14BN4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
     429-828: Missing.

Note: No experimental confirmation available.
Show »
Length:428
Mass (Da):49,177
Checksum:i103B2A7E6103D7DF
GO
Isoform 8 (identifier: Q14BN4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     484-524: Missing.
     754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
     779-828: Missing.

Note: No experimental confirmation available.
Show »
Length:271
Mass (Da):31,437
Checksum:i84CA2BC512502DF9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z964B7Z964_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
362Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3M8H7C3M8_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
409Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZK0H7BZK0_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
433Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZW9H7BZW9_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
316Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z863B7Z863_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5S2H7C5S2_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5G9H7C5G9_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCH4C9JCH4_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JA20C9JA20_HUMAN
Sarcolemmal membrane-associated pro...
SLMAP
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ88776 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAH10369 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti493I → T in AAG41949 (PubMed:10986292).Curated1
Sequence conflicti515T → A in AAG41949 (PubMed:10986292).Curated1
Sequence conflicti812A → Q in AAD43014 (PubMed:11042152).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0214991 – 466Missing in isoform 5 and isoform 8. 2 PublicationsAdd BLAST466
Alternative sequenceiVSP_0215001 – 348Missing in isoform 4. 1 PublicationAdd BLAST348
Alternative sequenceiVSP_021501379 – 436Missing in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_021502379 – 417VRLEH…IECQK → E in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_021503379 – 395Missing in isoform 3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_021504396 – 428EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021505396 – 417EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021506429 – 828Missing in isoform 7. 1 PublicationAdd BLAST400
Alternative sequenceiVSP_021507484 – 524Missing in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_021508484 – 510DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_021509511 – 828Missing in isoform 6. 1 PublicationAdd BLAST318
Alternative sequenceiVSP_021510754 – 778YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_021511779 – 828Missing in isoform 8. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_021512798N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. 1 Publication1
Alternative sequenceiVSP_021513799 – 828KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF304450 mRNA Translation: AAG41949.1
AF100750 mRNA Translation: AAD43014.1
AY358410 mRNA Translation: AAQ88776.1 Different initiation.
AK124200 mRNA Translation: BAC85803.1
AL834538 mRNA Translation: CAD39194.1
CR627321 mRNA Translation: CAH10369.1 Different initiation.
BC114627 mRNA Translation: AAI14628.1
BC115701 mRNA Translation: AAI15702.1
AB046821 mRNA Translation: BAB13427.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33774.1 [Q14BN4-3]
CCDS77757.1 [Q14BN4-1]
CCDS77758.1 [Q14BN4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001291349.1, NM_001304420.2 [Q14BN4-1]
NP_001291350.1, NM_001304421.2 [Q14BN4-2]
NP_001298107.1, NM_001311178.1 [Q14BN4-5]
NP_001298108.1, NM_001311179.1 [Q14BN4-8]
NP_009090.2, NM_007159.4 [Q14BN4-3]
XP_005265518.1, XM_005265461.3 [Q14BN4-1]
XP_005265523.1, XM_005265466.3 [Q14BN4-3]
XP_005265528.1, XM_005265471.3 [Q14BN4-2]
XP_016862659.1, XM_017007170.1 [Q14BN4-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000295951; ENSP00000295951; ENSG00000163681 [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681 [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681 [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681 [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681 [Q14BN4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7871

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7871

UCSC genome browser

More...
UCSCi
uc003djc.2 human [Q14BN4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304450 mRNA Translation: AAG41949.1
AF100750 mRNA Translation: AAD43014.1
AY358410 mRNA Translation: AAQ88776.1 Different initiation.
AK124200 mRNA Translation: BAC85803.1
AL834538 mRNA Translation: CAD39194.1
CR627321 mRNA Translation: CAH10369.1 Different initiation.
BC114627 mRNA Translation: AAI14628.1
BC115701 mRNA Translation: AAI15702.1
AB046821 mRNA Translation: BAB13427.1
CCDSiCCDS33774.1 [Q14BN4-3]
CCDS77757.1 [Q14BN4-1]
CCDS77758.1 [Q14BN4-2]
RefSeqiNP_001291349.1, NM_001304420.2 [Q14BN4-1]
NP_001291350.1, NM_001304421.2 [Q14BN4-2]
NP_001298107.1, NM_001311178.1 [Q14BN4-5]
NP_001298108.1, NM_001311179.1 [Q14BN4-8]
NP_009090.2, NM_007159.4 [Q14BN4-3]
XP_005265518.1, XM_005265461.3 [Q14BN4-1]
XP_005265523.1, XM_005265466.3 [Q14BN4-3]
XP_005265528.1, XM_005265471.3 [Q14BN4-2]
XP_016862659.1, XM_017007170.1 [Q14BN4-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6AKMX-ray2.30B167-226[»]
6AR0X-ray1.08A1-140[»]
6AR2X-ray1.55A/B1-140[»]
SMRiQ14BN4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113620, 70 interactors
IntActiQ14BN4, 51 interactors
MINTiQ14BN4
STRINGi9606.ENSP00000295951

PTM databases

iPTMnetiQ14BN4
PhosphoSitePlusiQ14BN4

Polymorphism and mutation databases

BioMutaiSLMAP
DMDMi118597508

Proteomic databases

EPDiQ14BN4
jPOSTiQ14BN4
MaxQBiQ14BN4
PaxDbiQ14BN4
PeptideAtlasiQ14BN4
PRIDEiQ14BN4
ProteomicsDBi60298
60299 [Q14BN4-2]
60300 [Q14BN4-3]
60301 [Q14BN4-4]
60302 [Q14BN4-5]
60303 [Q14BN4-6]
60304 [Q14BN4-7]
60305 [Q14BN4-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681 [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681 [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681 [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681 [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681 [Q14BN4-2]
GeneIDi7871
KEGGihsa:7871
UCSCiuc003djc.2 human [Q14BN4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7871
DisGeNETi7871

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLMAP
GeneReviewsiSLMAP

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0003396
HGNCiHGNC:16643 SLMAP
HPAiHPA002357
HPA002358
MalaCardsiSLMAP
MIMi602701 gene
neXtProtiNX_Q14BN4
OpenTargetsiENSG00000163681
Orphaneti130 Brugada syndrome
PharmGKBiPA38179

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3872 Eukaryota
COG1716 LUCA
GeneTreeiENSGT00940000157660
InParanoidiQ14BN4
OMAiTKQEIQH
OrthoDBi664798at2759
PhylomeDBiQ14BN4
TreeFamiTF318787

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLMAP human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLMAP

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7871

Protein Ontology

More...
PROi
PR:Q14BN4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163681 Expressed in 203 organ(s), highest expression level in myometrium
ExpressionAtlasiQ14BN4 baseline and differential
GenevisibleiQ14BN4 HS

Family and domain databases

CDDicd00060 FHA, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR030498 SLMAP
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR15715:SF22 PTHR15715:SF22, 1 hit
PfamiView protein in Pfam
PF00498 FHA, 1 hit
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSLMAP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14BN4
Secondary accession number(s): Q14C95
, Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: August 22, 2006
Last modified: May 8, 2019
This is version 118 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again