Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (13 Nov 2019)
Sequence version 2 (01 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

E3 ubiquitin-protein ligase SHPRH

Gene

SHPRH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase involved in DNA repair. Upon genotoxic stress, accepts ubiquitin from the UBE2N-UBE2V2 E2 complex and transfers it to 'Lys-164' of PCNA which had been monoubiquitinated by UBE2A/B-RAD18, promoting the formation of non-canonical poly-ubiquitin chains linked through 'Lys-63'.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi373 – 380ATPPROSITE-ProRule annotation8
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri658 – 709PHD-typeAdd BLAST52
Zinc fingeri1432 – 1479RING-typePROSITE-ProRule annotationAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHelicase, Hydrolase, Transferase
Biological processDNA damage, DNA repair, Ubl conjugation pathway
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q149N8

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SHPRH (EC:2.3.2.27, EC:3.6.4.-)
Alternative name(s):
RING-type E3 ubiquitin transferase SHPRHCurated
SNF2, histone-linker, PHD and RING finger domain-containing helicase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHPRH
Synonyms:KIAA2023
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19336 SHPRH

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608048 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q149N8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1432C → A: Abolishes E3 activity. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000146414

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134880315

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q149N8

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SHPRH

Domain mapping of disease mutations (DMDM)

More...
DMDMi
146325723

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002849181 – 1683E3 ubiquitin-protein ligase SHPRHAdd BLAST1683

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei266PhosphoserineCombined sources1
Modified residuei635PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q149N8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q149N8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q149N8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q149N8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q149N8

PeptideAtlas

More...
PeptideAtlasi
Q149N8

PRoteomics IDEntifications database

More...
PRIDEi
Q149N8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60294 [Q149N8-1]
60295 [Q149N8-2]
60296 [Q149N8-4]
60297 [Q149N8-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q149N8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q149N8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146414 Expressed in 194 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q149N8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q149N8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034854
HPA034950

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with HLTF, PCNA, UBE2N and RAD18.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129208, 24 interactors

Database of interacting proteins

More...
DIPi
DIP-46277N

Protein interaction database and analysis system

More...
IntActi
Q149N8, 16 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000356475

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11683
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q149N8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini307 – 389Helicase ATP-binding; first partPROSITE-ProRule annotationAdd BLAST83
Domaini438 – 512H15PROSITE-ProRule annotationAdd BLAST75
Domaini710 – 868Helicase ATP-binding; second partPROSITE-ProRule annotationAdd BLAST159
Domaini1514 – 1672Helicase C-terminalPROSITE-ProRule annotationAdd BLAST159

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi819 – 822DEAQ box4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING finger mediates E3 ubiquitin ligase activity.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri658 – 709PHD-typeAdd BLAST52
Zinc fingeri1432 – 1479RING-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0298 Eukaryota
COG0553 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111123

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q149N8

KEGG Orthology (KO)

More...
KOi
K15710

Database of Orthologous Groups

More...
OrthoDBi
357670at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q149N8

TreeFam database of animal gene trees

More...
TreeFami
TF324273

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00073 H15, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit
3.30.40.10, 2 hits
3.40.50.10810, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR005818 Histone_H1/H5_H15
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00271 Helicase_C, 1 hit
PF00538 Linker_histone, 1 hit
PF00176 SNF2_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00487 DEXDc, 1 hit
SM00526 H15, 1 hit
SM00490 HELICc, 1 hit
SM00249 PHD, 1 hit
SM00184 RING, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit
SSF52540 SSF52540, 3 hits
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51504 H15, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q149N8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSRRKRAPP VRVDEEKRQQ LHWNMHEDRR NEPIIISDDD EQPCPGSDTS
60 70 80 90 100
SAHYIILSDS LKEEVAHRDK KRCSKVVSFS KPIEKEETVG IFSPLSVKLN
110 120 130 140 150
IVISPYHFDN SWKAFLGELT LQLLPAQSLI ENFSERSITL MSSESSNQFL
160 170 180 190 200
IYVHSKGEDV EKQKKEPMSI CDKGILVESS FSGEMLEDLG WLQKKRRIKL
210 220 230 240 250
YQKPEGNHII KVGIYLLEAG LAKLDFLSDA NSRMKKFNQL MKKVMEKLHN
260 270 280 290 300
SIIPDVLEED EDDPESEPEG QDIDELYHFV KQTHQQETQS IQVDVQHPAL
310 320 330 340 350
IPVLRPYQRE AVNWMLQQEC FRSSPATESA LHFLWREIVT SEGLKLYYNP
360 370 380 390 400
YTGCIIREYP NSGPQLLGGI LADEMGLGKT VEVLALILTH TRQDVKQDAL
410 420 430 440 450
TLPEGKVVNY FIPSHYFGGK LKKTEIQNIE FEPKEKVQCP PTRVMILTAV
460 470 480 490 500
KEMNGKKGVS ILSIYKYVSS IYRYDVQRNR SLLKRMLKCL IFEGLVKQIK
510 520 530 540 550
GHGFSGTFTL GKNYKEEDIC DKTKKQAVGS PRKIQKETRK SGNKDTDSEY
560 570 580 590 600
LPSDTSDDDD DPYYYYYKSR RNRSKLRKKL VPSTKKGKSQ PFINPDSQGH
610 620 630 640 650
CPATSDSGIT DVAMSKSTCI SEFNQEHETE DCAESLNHAD SDVPPSNTMS
660 670 680 690 700
PFNTSDYRFE CICGELDQID RKPRVQCLKC HLWQHAKCVN YDEKNLKIKP
710 720 730 740 750
FYCPHCLVAM EPVSTRATLI ISPSSICHQW VDEINRHVRS SSLRVLVYQG
760 770 780 790 800
VKKDGFLQPH FLAEQDIVII TYDVLRSELN YVDIPHSNSE DGRRLRNQKR
810 820 830 840 850
YMAIPSPLVA VEWWRICLDE AQMVECPTVK AAEMAQRLSG INRWCISGTP
860 870 880 890 900
VQRGLEDLFG LVVFLGIEPY CVKHWWVRLL YRPYCKKNPQ HLYSFIAKIL
910 920 930 940 950
WRSAKKDVID QIQIPPQTEE IHWLHFSPVE RHFYHRQHEV CCQDVVVKLR
960 970 980 990 1000
KISDWALKLS SLDRRTVTSI LYPLLRLRQA CCHPQAVRGE FLPLQKSTMT
1010 1020 1030 1040 1050
MEELLTSLQK KCGTECEEAH RQLVCALNGL AGIHIIKGEY ALAAELYREV
1060 1070 1080 1090 1100
LRSSEEHKGK LKTDSLQRLH ATHNLMELLI ARHPGIPPTL RDGRLEEEAK
1110 1120 1130 1140 1150
QLREHYMSKC NTEVAEAQQA LYPVQQTIHE LQRKIHSNSP WWLNVIHRAI
1160 1170 1180 1190 1200
EFTIDEELVQ RVRNEITSNY KQQTGKLSMS EKFRDCRGLQ FLLTTQMEEL
1210 1220 1230 1240 1250
NKCQKLVREA VKNLEGPPSR NVIESATVCH LRPARLPLNC CVFCKADELF
1260 1270 1280 1290 1300
TEYESKLFSN TVKGQTAIFE EMIEDEEGLV DDRAPTTTRG LWAISETERS
1310 1320 1330 1340 1350
MKAILSFAKS HRFDVEFVDE GSTSMDLFEA WKKEYKLLHE YWMALRNRVS
1360 1370 1380 1390 1400
AVDELAMATE RLRVRDPREP KPNPPVLHII EPHEVEQNRI KLLNDKAVAT
1410 1420 1430 1440 1450
SQLQKKLGQL LYLTNLEKSQ DKTSGGVNPE PCPICARQLG KQWAVLTCGH
1460 1470 1480 1490 1500
CFCNECISII IEQYSVGSHR SSIKCAICRQ TTSHKEISYV FTSEKANQEE
1510 1520 1530 1540 1550
DIPVKGSHST KVEAVVRTLM KIQLRDPGAK ALVFSTWQDV LDIISKALTD
1560 1570 1580 1590 1600
NNMEFAQISR VKTFQENLSA FKRDPQINIL LLPLHTGSNG LTIIEATHVL
1610 1620 1630 1640 1650
LVEPILNPAH ELQAIGRVHR IGQTKPTIVH RFLIKATIEE RMQAMLKTAE
1660 1670 1680
RSHTNSSAKH SEASVLTVAD LADLFTKETE ELE
Length:1,683
Mass (Da):193,079
Last modified:May 1, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3EAA1433EF89B232
GO
Isoform 2 (identifier: Q149N8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-156: Missing.
     1039-1040: EY → RR
     1041-1683: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:929
Mass (Da):107,341
Checksum:i053D4616BE6C508C
GO
Isoform 3 (identifier: Q149N8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     996-996: K → KSFEQSTFSF
     1183-1187: Missing.
     1653-1655: HTN → IYI
     1656-1683: Missing.

Note: No experimental confirmation available.
Show »
Length:1,659
Mass (Da):190,497
Checksum:iA97C8EC77CBABFD7
GO
Isoform 4 (identifier: Q149N8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     442-471: TRVMILTAVKEMNGKKGVSILSIYKYVSSI → YPFTFSYTCDDTDSCERNEWKKRSVHPFHL
     472-1683: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:471
Mass (Da):54,339
Checksum:iC602569D075A3DC0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0D9SFM0A0A0D9SFM0_HUMAN
E3 ubiquitin-protein ligase SHPRH
SHPRH hCG_18061
1,687Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K4DI94K4DI94_HUMAN
E3 ubiquitin-protein ligase SHPRH
SHPRH
660Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2W2H7C2W2_HUMAN
E3 ubiquitin-protein ligase SHPRH
SHPRH
449Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBI0H0YBI0_HUMAN
E3 ubiquitin-protein ligase SHPRH
SHPRH
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JT88Q5JT88_HUMAN
E3 ubiquitin-protein ligase SHPRH
SHPRH
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI13090 differs from that shown. Aberrant splicing.Curated
The sequence AAI17686 differs from that shown. Aberrant splicing.Curated
The sequence BAC04459 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC23119 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence CAH18145 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti185M → V in CAH18145 (PubMed:17974005).Curated1
Sequence conflicti379K → E in BAC11544 (PubMed:14702039).Curated1
Sequence conflicti425E → G in BAC11544 (PubMed:14702039).Curated1
Sequence conflicti560D → G in CAH18145 (PubMed:17974005).Curated1
Sequence conflicti1398V → F in AAI17687 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031857438Q → R in an ovarian cancer cell line. 1 PublicationCorresponds to variant dbSNP:rs1411096648Ensembl.1
Natural variantiVAR_031858460S → F in a melanoma cell line. 1 Publication1
Natural variantiVAR_0318591028N → Y in a melanoma cell line. 1 Publication1
Natural variantiVAR_0647501222V → D Found in a renal cell carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02475346 – 156Missing in isoform 2. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_024760442 – 471TRVMI…YVSSI → YPFTFSYTCDDTDSCERNEW KKRSVHPFHL in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_024761472 – 1683Missing in isoform 4. 1 PublicationAdd BLAST1212
Alternative sequenceiVSP_024756996K → KSFEQSTFSF in isoform 3. 1 Publication1
Alternative sequenceiVSP_0247571039 – 1040EY → RR in isoform 2. 1 Publication2
Alternative sequenceiVSP_0247581041 – 1683Missing in isoform 2. 1 PublicationAdd BLAST643
Alternative sequenceiVSP_0247591183 – 1187Missing in isoform 3. 1 Publication5
Alternative sequenceiVSP_0247621653 – 1655HTN → IYI in isoform 3. 1 Publication3
Alternative sequenceiVSP_0247631656 – 1683Missing in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY161136 mRNA Translation: AAO26201.1
AY163808 mRNA Translation: AAO06907.1
CR749290 mRNA Translation: CAH18145.1 Frameshift.
AL356599 Genomic DNA No translation available.
AL451145 Genomic DNA No translation available.
BC113089 mRNA Translation: AAI13090.1 Sequence problems.
BC117685 mRNA Translation: AAI17686.1 Sequence problems.
BC117686 mRNA Translation: AAI17687.1
AK075318 mRNA Translation: BAC11544.1
AK094944 mRNA Translation: BAC04459.1 Different initiation.
AB095943 mRNA Translation: BAC23119.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43513.2 [Q149N8-1]
CCDS47496.1 [Q149N8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001036148.2, NM_001042683.2 [Q149N8-1]
NP_775105.1, NM_173082.3 [Q149N8-4]
XP_006715504.1, XM_006715441.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000275233; ENSP00000275233; ENSG00000146414 [Q149N8-1]
ENST00000367505; ENSP00000356475; ENSG00000146414 [Q149N8-1]
ENST00000438092; ENSP00000412797; ENSG00000146414 [Q149N8-4]
ENST00000519632; ENSP00000430528; ENSG00000146414 [Q149N8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
257218

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:257218

UCSC genome browser

More...
UCSCi
uc003qle.4 human [Q149N8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY161136 mRNA Translation: AAO26201.1
AY163808 mRNA Translation: AAO06907.1
CR749290 mRNA Translation: CAH18145.1 Frameshift.
AL356599 Genomic DNA No translation available.
AL451145 Genomic DNA No translation available.
BC113089 mRNA Translation: AAI13090.1 Sequence problems.
BC117685 mRNA Translation: AAI17686.1 Sequence problems.
BC117686 mRNA Translation: AAI17687.1
AK075318 mRNA Translation: BAC11544.1
AK094944 mRNA Translation: BAC04459.1 Different initiation.
AB095943 mRNA Translation: BAC23119.1 Sequence problems.
CCDSiCCDS43513.2 [Q149N8-1]
CCDS47496.1 [Q149N8-4]
RefSeqiNP_001036148.2, NM_001042683.2 [Q149N8-1]
NP_775105.1, NM_173082.3 [Q149N8-4]
XP_006715504.1, XM_006715441.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M85NMR-A652-716[»]
4QN1X-ray2.48A1000-1418[»]
SMRiQ149N8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi129208, 24 interactors
DIPiDIP-46277N
IntActiQ149N8, 16 interactors
STRINGi9606.ENSP00000356475

PTM databases

iPTMnetiQ149N8
PhosphoSitePlusiQ149N8

Polymorphism and mutation databases

BioMutaiSHPRH
DMDMi146325723

Proteomic databases

EPDiQ149N8
jPOSTiQ149N8
MassIVEiQ149N8
MaxQBiQ149N8
PaxDbiQ149N8
PeptideAtlasiQ149N8
PRIDEiQ149N8
ProteomicsDBi60294 [Q149N8-1]
60295 [Q149N8-2]
60296 [Q149N8-4]
60297 [Q149N8-5]

Genome annotation databases

EnsembliENST00000275233; ENSP00000275233; ENSG00000146414 [Q149N8-1]
ENST00000367505; ENSP00000356475; ENSG00000146414 [Q149N8-1]
ENST00000438092; ENSP00000412797; ENSG00000146414 [Q149N8-4]
ENST00000519632; ENSP00000430528; ENSG00000146414 [Q149N8-2]
GeneIDi257218
KEGGihsa:257218
UCSCiuc003qle.4 human [Q149N8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
257218

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHPRH
HGNCiHGNC:19336 SHPRH
HPAiHPA034854
HPA034950
MIMi608048 gene
neXtProtiNX_Q149N8
OpenTargetsiENSG00000146414
PharmGKBiPA134880315

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0298 Eukaryota
COG0553 LUCA
GeneTreeiENSGT00730000111123
InParanoidiQ149N8
KOiK15710
OrthoDBi357670at2759
PhylomeDBiQ149N8
TreeFamiTF324273

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins
SIGNORiQ149N8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SHPRH human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SHPRH

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
257218
PharosiQ149N8

Protein Ontology

More...
PROi
PR:Q149N8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146414 Expressed in 194 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ149N8 baseline and differential
GenevisibleiQ149N8 HS

Family and domain databases

CDDicd00073 H15, 1 hit
Gene3Di1.10.10.10, 1 hit
3.30.40.10, 2 hits
3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR005818 Histone_H1/H5_H15
IPR027417 P-loop_NTPase
IPR038718 SNF2-like_sf
IPR000330 SNF2_N
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00271 Helicase_C, 1 hit
PF00538 Linker_histone, 1 hit
PF00176 SNF2_N, 1 hit
SMARTiView protein in SMART
SM00487 DEXDc, 1 hit
SM00526 H15, 1 hit
SM00490 HELICc, 1 hit
SM00249 PHD, 1 hit
SM00184 RING, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF52540 SSF52540, 3 hits
SSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51504 H15, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
PS01359 ZF_PHD_1, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHPRH_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q149N8
Secondary accession number(s): Q149N9
, Q5VV79, Q68DS5, Q7Z5J5, Q8IVE8, Q8IWQ9, Q8N1S8, Q8NBR7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: November 13, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again