Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cullin-7

Gene

CUL7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Core component of the 3M and Cul7-RING(FBXW8) complexes, which mediates the ubiquitination of target proteins. Core component of the 3M complex, a complex required to regulate microtubule dynamics and genome integrity. It is unclear how the 3M complex regulates microtubules, it could act by controlling the level of a microtubule stabilizer (PubMed:24793695). Interaction with CUL9 is required to inhibit CUL9 activity and ubiquitination of BIRC5 (PubMed:24793696). Core component of a Cul7-RING ubiquitin-protein ligase with FBXW8, which mediates ubiquitination and consequent degradation of target proteins such as GORASP1, IRS1 and MAP4K1/HPK1 (PubMed:21572988, PubMed:24362026). Ubiquitination of GORASP1 regulates Golgi morphogenesis and dendrite patterning in brain (PubMed:21572988). Mediates ubiquitination and degradation of IRS1 in a mTOR-dependent manner: the Cul7-RING(FBXW8) complex recognizes and binds IRS1 previously phosphorylated by S6 kinase (RPS6KB1 or RPS6KB2) (PubMed:18498745). The Cul7-RING(FBXW8) complex also mediates ubiquitination of MAP4K1/HPK1: recognizes and binds autophosphorylated MAP4K1/HPK1, leading to its degradation, thereby affecting cell proliferation and differentiation (PubMed:24362026). Acts as a regulator in trophoblast cell epithelial-mesenchymal transition and placental development (PubMed:20139075). Does not promote polyubiquitination and proteasomal degradation of p53/TP53 (PubMed:16547496, PubMed:17332328). While the Cul7-RING(FBXW8) and the 3M complexes are associated and involved in common processes, CUL7 and the Cul7-RING(FBXW8) complex may be have additional functions.8 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

  • epithelial to mesenchymal transition Source: UniProtKB
  • Golgi organization Source: UniProtKB
  • IRE1-mediated unfolded protein response Source: Reactome
  • microtubule cytoskeleton organization Source: UniProtKB
  • mitotic cytokinesis Source: UniProtKB
  • placenta development Source: UniProtKB
  • positive regulation of dendrite morphogenesis Source: UniProtKB
  • post-translational protein modification Source: Reactome
  • protein ubiquitination Source: UniProtKB
  • proteolysis Source: UniProtKB
  • regulation of mitotic nuclear division Source: UniProtKB
  • ubiquitin-dependent protein catabolic process Source: InterPro
  • vasculogenesis Source: UniProtKB
  • viral process Source: UniProtKB-KW

Keywordsi

Biological processHost-virus interaction, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ14999
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Cullin-7
Short name:
CUL-7
Gene namesi
Name:CUL7
Synonyms:KIAA0076
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000044090.8
HGNCiHGNC:21024 CUL7
MIMi609577 gene
neXtProtiNX_Q14999

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

Pathology & Biotechi

Involvement in diseasei

3M syndrome 1 (3M1)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by severe pre- and postnatal growth retardation, facial dysmorphism, large head circumference, and normal intelligence and endocrine function. Skeletal changes include long slender tubular bones and tall vertebral bodies.
See also OMIM:273750
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0261221014L → R in 3M1; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs61752334EnsemblClinVar.1
Natural variantiVAR_0261231246Q → G in 3M1; requires 2 nucleotide substitutions. 1 Publication1
Natural variantiVAR_0261241464H → P in 3M1; impairs the ability to interact with RBX1, thus hampers the assembly of polyubiquitin chains. 1 PublicationCorresponds to variant dbSNP:rs121918229EnsemblClinVar.1
Natural variantiVAR_0711201588L → P in 3M1. 1 PublicationCorresponds to variant dbSNP:rs759300846Ensembl.1

Keywords - Diseasei

Disease mutation, Dwarfism

Organism-specific databases

DisGeNETi9820
GeneReviewsiCUL7
MalaCardsiCUL7
MIMi273750 phenotype
OpenTargetsiENSG00000044090
Orphaneti2616 3M syndrome
PharmGKBiPA134897835

Polymorphism and mutation databases

BioMutaiCUL7
DMDMi160370003

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001198021 – 1698Cullin-7Add BLAST1698

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei339PhosphoserineCombined sources1
Cross-linki1576Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in NEDD8)Sequence analysis

Post-translational modificationi

According to a report, may not be neddylated despite the conserved consensus site for neddylation at Lys-1576.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ14999
MaxQBiQ14999
PaxDbiQ14999
PeptideAtlasiQ14999
PRIDEiQ14999
ProteomicsDBi60290

PTM databases

iPTMnetiQ14999
PhosphoSitePlusiQ14999

Expressioni

Tissue specificityi

Highly expressed in fetal kidney and adult skeletal muscle. Also abundant in fetal brain, as well as in adult pancreas, kidney, placenta and heart. Detected in trophoblasts, lymphoblasts, osteoblasts, chondrocytes and skin fibroblasts.1 Publication

Developmental stagei

Highly expressed in invasive placental villi during first trimester.1 Publication

Gene expression databases

BgeeiENSG00000044090 Expressed in 208 organ(s), highest expression level in adenohypophysis
CleanExiHS_CUL7
GenevisibleiQ14999 HS

Organism-specific databases

HPAiCAB015449
HPA030095
HPA030096

Interactioni

Subunit structurei

Component of the 3M complex, composed of core components CUL7, CCDC8 and OBSL1. Part of a Cul7-RING complex consisting of CUL7, RBX1, SKP1 and FBXW8. Interacts with a complex of SKP1 and FBXW8, but not with SKP1 alone. Interacts with CUL9; leading to inhibit CUL9 activity. Interacts with FBXW8; interaction is mutually exclusive of binding to CUL9 or p53/TP53. Interacts with p53/TP53; the interaction preferentially involves tetrameric and dimeric p53/TP53. The CUL7-CUL9 heterodimer seems to interact specifically with p53/TP53. Interacts with CUL1; the interactions seems to be mediated by FBXW8. Interacts with OBSL1. Interacts (as part of the 3M complex) with HDAC4 and HDAC5; it is negatively regulated by ANKRA2.12 Publications
(Microbial infection) Interacts with SV40 Large T antigen; this interaction seems to inhibit CUL7.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115159, 661 interactors
CORUMiQ14999
DIPiDIP-31618N
DIP-60187N
IntActiQ14999, 16 interactors
MINTiQ14999
STRINGi9606.ENSP00000438788

Structurei

Secondary structure

11698
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14999
SMRiQ14999
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14999

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini814 – 993DOCPROSITE-ProRule annotationAdd BLAST180

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni360 – 460Interaction with TP53Add BLAST101

Sequence similaritiesi

Belongs to the cullin family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1815 Eukaryota
ENOG410XP9Y LUCA
GeneTreeiENSGT00890000139411
HOGENOMiHOG000024831
HOVERGENiHBG103792
InParanoidiQ14999
KOiK10613
OMAiWKPMTEL
OrthoDBiEOG091G0053
PhylomeDBiQ14999
TreeFamiTF101154

Family and domain databases

Gene3Di2.30.30.30, 1 hit
2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR004939 APC_su10/DOC_dom
IPR016024 ARM-type_fold
IPR021097 CPH_domain
IPR031223 CUL7
IPR016158 Cullin_homology
IPR036317 Cullin_homology_sf
IPR001373 Cullin_N
IPR019559 Cullin_neddylation_domain
IPR008979 Galactose-bd-like_sf
IPR014722 Rib_L2_dom2
PANTHERiPTHR22771:SF3 PTHR22771:SF3, 1 hit
PfamiView protein in Pfam
PF03256 ANAPC10, 1 hit
PF11515 Cul7, 1 hit
PF00888 Cullin, 1 hit
SMARTiView protein in SMART
SM01337 APC10, 1 hit
SM00884 Cullin_Nedd8, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
SSF49785 SSF49785, 1 hit
SSF75632 SSF75632, 1 hit
PROSITEiView protein in PROSITE
PS50069 CULLIN_2, 1 hit
PS51284 DOC, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q14999-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVGELRYREF RVPLGPGLHA YPDELIRQRV GHDGHPEYQI RWLILRRGDE
60 70 80 90 100
GDGGSGQVDC KAEHILLWMS KDEIYANCHK MLGEDGQVIG PSQESAGEVG
110 120 130 140 150
ALDKSVLEEM ETDVKSLIQR ALRQLEECVG TIPPAPLLHT VHVLSAYASI
160 170 180 190 200
EPLTGVFKDP RVLDLLMHML SSPDYQIRWS AGRMIQALSS HDAGTRTQIL
210 220 230 240 250
LSLSQQEAIE KHLDFDSRCA LLALFAQATL SEHPMSFEGI QLPQVPGRVL
260 270 280 290 300
FSLVKRYLHV TSLLDQLNDS AAEPGAQNTS APEELSGERG QLELEFSMAM
310 320 330 340 350
GTLISELVQA MRWDQASDRP RSSARSPGSI FQPQLADVSP GLPAAQAQPS
360 370 380 390 400
FRRSRRFRPR SEFASGNTYA LYVRDTLQPG MRVRMLDDYE EISAGDEGEF
410 420 430 440 450
RQSNNGVPPV QVFWESTGRT YWVHWHMLEI LGFEEDIEDM VEADEYQGAV
460 470 480 490 500
ASRVLGRALP AWRWRPMTEL YAVPYVLPED EDTEECEHLT LAEWWELLFF
510 520 530 540 550
IKKLDGPDHQ EVLQILQENL DGEILDDEIL AELAVPIELA QDLLLTLPQR
560 570 580 590 600
LNDSALRDLI NCHVYKKYGP EALAGNQAYP SLLEAQEDVL LLDAQAQAKD
610 620 630 640 650
SEDAAKVEAK EPPSQSPNTP LQRLVEGYGP AGKILLDLEQ ALSSEGTQEN
660 670 680 690 700
KVKPLLLQLQ RQPQPFLALM QSLDTPETNR TLHLTVLRIL KQLVDFPEAL
710 720 730 740 750
LLPWHEAVDA CMACLRSPNT DREVLQELIF FLHRLTSVSR DYAVVLNQLG
760 770 780 790 800
ARDAISKALE KHLGKLELAQ ELRDMVFKCE KHAHLYRKLI TNILGGCIQM
810 820 830 840 850
VLGQIEDHRR THQPINIPFF DVFLRYLCQG SSVEVKEDKC WEKVEVSSNP
860 870 880 890 900
HRASKLTDHN PKTYWESNGS AGSHYITLHM RRGILIRQLT LLVASEDSSY
910 920 930 940 950
MPARVVVCGG DSTSSLHTEL NSVNVMPSAS RVILLENLTR FWPIIQIRIK
960 970 980 990 1000
RCQQGGIDTR IRGLEILGPK PTFWPVFREQ LCRHTRLFYM VRAQAWSQDM
1010 1020 1030 1040 1050
AEDRRSLLHL SSRLNGALRQ EQNFADRFLP DDEAAQALGK TCWEALVSPV
1060 1070 1080 1090 1100
VQNITSPDED GISPLGWLLD QYLECQEAVF NPQSRGPAFF SRVRRLTHLL
1110 1120 1130 1140 1150
VHVEPCEAPP PVVATPRPKG RNRSHDWSSL ATRGLPSSIM RNLTRCWRAV
1160 1170 1180 1190 1200
VEKQVNNFLT SSWRDDDFVP RYCEHFNILQ NSSSELFGPR AAFLLALQNG
1210 1220 1230 1240 1250
CAGALLKLPF LKAAHVSEQF ARHIDQQIQG SRIGGAQEME RLAQLQQCLQ
1260 1270 1280 1290 1300
AVLIFSGLEI ATTFEHYYQH YMADRLLGVV SSWLEGAVLE QIGPCFPNRL
1310 1320 1330 1340 1350
PQQMLQSLST SKELQRQFHV YQLQQLDQEL LKLEDTEKKI QVGLGASGKE
1360 1370 1380 1390 1400
HKSEKEEEAG AAAVVDVAEG EEEEEENEDL YYEGAMPEVS VLVLSRHSWP
1410 1420 1430 1440 1450
VASICHTLNP RTCLPSYLRG TLNRYSNFYN KSQSHPALER GSQRRLQWTW
1460 1470 1480 1490 1500
LGWAELQFGN QTLHVSTVQM WLLLYLNDLK AVSVESLLAF SGLSADMLNQ
1510 1520 1530 1540 1550
AIGPLTSSRG PLDLHEQKDI PGGVLKIRDG SKEPRSRWDI VRLIPPQTYL
1560 1570 1580 1590 1600
QAEGEDGQNL EKRRNLLNCL IVRILKAHGD EGLHIDQLVC LVLEAWQKGP
1610 1620 1630 1640 1650
CPPRGLVSSL GKGSACSSTD VLSCILHLLG KGTLRRHDDR PQVLSYAVPV
1660 1670 1680 1690
TVMEPHTESL NPGSSGPNPP LTFHTLQIRS RGVPYASCTA TQSFSTFR
Length:1,698
Mass (Da):191,161
Last modified:October 23, 2007 - v2
Checksum:iEC9EED17E98FC9A1
GO
Isoform 2 (identifier: Q14999-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRGFWLAEPLAGTGPHPAPVAADSRGCSSVPRRHAPSRLSVSTPSRGPGARM
     194-194: G → GEGQCGEEGKAGEGLGRLRDSQDTVAGASDLIR

Note: No experimental confirmation available.
Show »
Length:1,782
Mass (Da):199,750
Checksum:i3CFC980A4E8C4EB2
GO

Sequence cautioni

The sequence BAA07551 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048841616S → G. Corresponds to variant dbSNP:rs7774330EnsemblClinVar.1
Natural variantiVAR_026121813Q → R3 PublicationsCorresponds to variant dbSNP:rs9381231EnsemblClinVar.1
Natural variantiVAR_048842852R → Q. Corresponds to variant dbSNP:rs34574340EnsemblClinVar.1
Natural variantiVAR_0261221014L → R in 3M1; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs61752334EnsemblClinVar.1
Natural variantiVAR_0261231246Q → G in 3M1; requires 2 nucleotide substitutions. 1 Publication1
Natural variantiVAR_0488431246Q → H. Corresponds to variant dbSNP:rs36071170Ensembl.1
Natural variantiVAR_0261241464H → P in 3M1; impairs the ability to interact with RBX1, thus hampers the assembly of polyubiquitin chains. 1 PublicationCorresponds to variant dbSNP:rs121918229EnsemblClinVar.1
Natural variantiVAR_0711201588L → P in 3M1. 1 PublicationCorresponds to variant dbSNP:rs759300846Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0461051M → MSRGFWLAEPLAGTGPHPAP VAADSRGCSSVPRRHAPSRL SVSTPSRGPGARM in isoform 2. 1 Publication1
Alternative sequenceiVSP_046106194G → GEGQCGEEGKAGEGLGRLRD SQDTVAGASDLIR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D38548 mRNA Translation: BAA07551.2 Different initiation.
AK302668 mRNA Translation: BAG63902.1
AL355385 Genomic DNA No translation available.
AL136304 Genomic DNA No translation available.
BC033647 mRNA Translation: AAH33647.1
CCDSiCCDS4881.1 [Q14999-1]
CCDS55003.1 [Q14999-2]
RefSeqiNP_001161842.1, NM_001168370.1 [Q14999-2]
NP_055595.2, NM_014780.4 [Q14999-1]
UniGeneiHs.520136

Genome annotation databases

EnsembliENST00000265348; ENSP00000265348; ENSG00000044090 [Q14999-1]
ENST00000535468; ENSP00000438788; ENSG00000044090 [Q14999-2]
GeneIDi9820
KEGGihsa:9820
UCSCiuc003otq.4 human [Q14999-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D38548 mRNA Translation: BAA07551.2 Different initiation.
AK302668 mRNA Translation: BAG63902.1
AL355385 Genomic DNA No translation available.
AL136304 Genomic DNA No translation available.
BC033647 mRNA Translation: AAH33647.1
CCDSiCCDS4881.1 [Q14999-1]
CCDS55003.1 [Q14999-2]
RefSeqiNP_001161842.1, NM_001168370.1 [Q14999-2]
NP_055595.2, NM_014780.4 [Q14999-1]
UniGeneiHs.520136

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JNGNMR-A360-460[»]
ProteinModelPortaliQ14999
SMRiQ14999
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115159, 661 interactors
CORUMiQ14999
DIPiDIP-31618N
DIP-60187N
IntActiQ14999, 16 interactors
MINTiQ14999
STRINGi9606.ENSP00000438788

PTM databases

iPTMnetiQ14999
PhosphoSitePlusiQ14999

Polymorphism and mutation databases

BioMutaiCUL7
DMDMi160370003

Proteomic databases

EPDiQ14999
MaxQBiQ14999
PaxDbiQ14999
PeptideAtlasiQ14999
PRIDEiQ14999
ProteomicsDBi60290

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265348; ENSP00000265348; ENSG00000044090 [Q14999-1]
ENST00000535468; ENSP00000438788; ENSG00000044090 [Q14999-2]
GeneIDi9820
KEGGihsa:9820
UCSCiuc003otq.4 human [Q14999-1]

Organism-specific databases

CTDi9820
DisGeNETi9820
EuPathDBiHostDB:ENSG00000044090.8
GeneCardsiCUL7
GeneReviewsiCUL7
HGNCiHGNC:21024 CUL7
HPAiCAB015449
HPA030095
HPA030096
MalaCardsiCUL7
MIMi273750 phenotype
609577 gene
neXtProtiNX_Q14999
OpenTargetsiENSG00000044090
Orphaneti2616 3M syndrome
PharmGKBiPA134897835
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1815 Eukaryota
ENOG410XP9Y LUCA
GeneTreeiENSGT00890000139411
HOGENOMiHOG000024831
HOVERGENiHBG103792
InParanoidiQ14999
KOiK10613
OMAiWKPMTEL
OrthoDBiEOG091G0053
PhylomeDBiQ14999
TreeFamiTF101154

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ14999

Miscellaneous databases

ChiTaRSiCUL7 human
EvolutionaryTraceiQ14999
GeneWikiiCUL7
GenomeRNAii9820
PROiPR:Q14999
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000044090 Expressed in 208 organ(s), highest expression level in adenohypophysis
CleanExiHS_CUL7
GenevisibleiQ14999 HS

Family and domain databases

Gene3Di2.30.30.30, 1 hit
2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR004939 APC_su10/DOC_dom
IPR016024 ARM-type_fold
IPR021097 CPH_domain
IPR031223 CUL7
IPR016158 Cullin_homology
IPR036317 Cullin_homology_sf
IPR001373 Cullin_N
IPR019559 Cullin_neddylation_domain
IPR008979 Galactose-bd-like_sf
IPR014722 Rib_L2_dom2
PANTHERiPTHR22771:SF3 PTHR22771:SF3, 1 hit
PfamiView protein in Pfam
PF03256 ANAPC10, 1 hit
PF11515 Cul7, 1 hit
PF00888 Cullin, 1 hit
SMARTiView protein in SMART
SM01337 APC10, 1 hit
SM00884 Cullin_Nedd8, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
SSF49785 SSF49785, 1 hit
SSF75632 SSF75632, 1 hit
PROSITEiView protein in PROSITE
PS50069 CULLIN_2, 1 hit
PS51284 DOC, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCUL7_HUMAN
AccessioniPrimary (citable) accession number: Q14999
Secondary accession number(s): B4DYZ0, F5H0L1, Q5T654
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 23, 2007
Last modified: November 7, 2018
This is version 183 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again