Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q14994 (NR1I3_HUMAN)

Entry version 204 (07 Apr 2021)
Sequence version 2 (21 Jun 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear receptor subfamily 1 group I member 3

Gene

NR1I3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi8 – 83Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri11 – 31NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri47 – 71NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q14994

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-383280, Nuclear Receptor transcription pathway

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q14994

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q14994

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001585

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor subfamily 1 group I member 3
Alternative name(s):
Constitutive activator of retinoid response
Short name:
Constitutive active response
Constitutive androstane receptor
Short name:
CAR
Orphan nuclear receptor MB67
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NR1I3
Synonyms:CAR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7969, NR1I3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603881, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q14994

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000143257.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9970

Open Targets

More...OpenTargetsi		ENSG00000143257

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA391

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q14994, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5503

Drug and drug target database

More...DrugBanki		DB01889, 16,17-Androstene-3-Ol
DB07557, 3,20-Pregnanedione
DB01076, Atorvastatin
DB04540, Cholesterol
DB00366, Doxylamine
DB07931, Hexestrol
DB01026, Ketoconazole
DB00836, Loperamide
DB00737, Meclizine
DB01620, Pheniramine
DB04824, Phenolphthalein
DB01708, Prasterone
DB02709, Resveratrol
DB08604, Triclosan

DrugCentral

More...DrugCentrali		Q14994

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		607

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NR1I3

Domain mapping of disease mutations (DMDM)

More...DMDMi		49066046

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535521 – 352Nuclear receptor subfamily 1 group I member 3Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei38Phosphothreonine; by PKC1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q14994

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q14994

PRoteomics IDEntifications database

More...PRIDEi		Q14994

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19162
19340
19747
20322
20436
20507
20570
60278 [Q14994-1]
60279 [Q14994-2]
60280 [Q14994-3]
60281 [Q14994-4]
60282 [Q14994-5]
60283 [Q14994-6]
60284 [Q14994-7]
62261

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q14994

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q14994

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in liver.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By dexamethasone.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000143257, Expressed in right lobe of liver and 124 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q14994, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q14994, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000143257, Tissue enriched (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ECT2 (By similarity). Heterodimer of NR1I3 and RXR.

Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90 (By similarity).

Interacts with CRY1 (By similarity).

Interacts with CRY2 in a ligand-dependent manner (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115295, 36 interactors

Protein interaction database and analysis system

More...IntActi		Q14994, 20 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000356959

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q14994

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q14994, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1352
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q14994

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q14994

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini109 – 352NR LBDPROSITE-ProRule annotationAdd BLAST244

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR1 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri11 – 31NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri47 – 71NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3575, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160641

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007368_12_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q14994

Identification of Orthologs from Complete Genome Data

More...OMAi		LPLLMHF

Database of Orthologous Groups

More...OrthoDBi		297114at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q14994

TreeFam database of animal gene trees

More...TreeFami		TF316304

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00475

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001728, ThyrH_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER
PR00546, THYROIDHORMR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (15+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 15 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 15 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14994-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASREDELRN CVVCGDQATG YHFNALTCEG CKGFFRRTVS KSIGPTCPFA 
        60         70         80         90        100
GSCEVSKTQR RHCPACRLQK CLDAGMRKDM ILSAEALALR RAKQAQRRAQ 
       110        120        130        140        150
QTPVQLSKEQ EELIRTLLGA HTRHMGTMFE QFVQFRPPAH LFIHHQPLPT 
       160        170        180        190        200
LAPVLPLVTH FADINTFMVL QVIKFTKDLP VFRSLPIEDQ ISLLKGAAVE 
       210        220        230        240        250
ICHIVLNTTF CLQTQNFLCG PLRYTIEDGA RVSPTVGFQV EFLELLFHFH 
       260        270        280        290        300
GTLRKLQLQE PEYVLLAAMA LFSPDRPGVT QRDEIDQLQE EMALTLQSYI 
       310        320        330        340        350
KGQQRRPRDR FLYAKLLGLL AELRSINEAY GYQIQHIQGL SAMMPLLQEI 

CS
Length:352
Mass (Da):39,942
Last modified:June 21, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i73B060FE4950D519
GO
Isoform 2 (identifier: Q14994-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-236: Missing.

Show »
Length:348
Mass (Da):39,558
Checksum:i92EAAD07D7DCB9DA
GO
Isoform 3 (identifier: Q14994-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: VSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSP → APYLT

Show »
Length:314
Mass (Da):35,588
Checksum:iEE9F842EF2B19A2E
GO
Isoform 4 (identifier: Q14994-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.

Show »
Length:280
Mass (Da):31,900
Checksum:i7F3BFA4F60A16FB1
GO
Isoform 5 (identifier: Q14994-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.

Show »
Length:319
Mass (Da):36,416
Checksum:iC41CFFC814E96E46
GO
Isoform 6 (identifier: Q14994-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT

Show »
Length:324
Mass (Da):36,961
Checksum:i32245F1A8C523B1E
GO
Isoform 7 (identifier: Q14994-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.

Show »
Length:309
Mass (Da):35,043
Checksum:i47BDCF4FC3777574
GO
Isoform 8 (identifier: Q14994-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     274-274: P → PAPYLT

Show »
Length:357
Mass (Da):40,488
Checksum:i1AF956D0A2759781
GO
Isoform 9 (identifier: Q14994-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:306
Mass (Da):34,778
Checksum:iEA8397560E3A2AC1
GO
Isoform 10 (identifier: Q14994-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:311
Mass (Da):35,323
Checksum:i88A1BD387DDFFF8B
GO
Isoform 11 (identifier: Q14994-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:315
Mass (Da):35,708
Checksum:iA90FF3A0E39D1305
GO
Isoform 12 (identifier: Q14994-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:339
Mass (Da):38,304
Checksum:iAEDAD58E1ECA2D6E
GO
Isoform 13 (identifier: Q14994-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-235: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:340
Mass (Da):38,466
Checksum:iC13708F49C3A2145
GO
Isoform 14 (identifier: Q14994-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:296
Mass (Da):33,405
Checksum:i3D8FC1261A54C270
GO
Isoform 15 (identifier: Q14994-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:267
Mass (Da):30,262
Checksum:i97343837A4943EFE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6REZ7D6REZ7_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
273Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PCF2E9PCF2_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
297Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z8R7B7Z8R7_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
238Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GZ81Q6GZ81_HUMAN
Constitutive androstane receptor SV...
NR1I3
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GZ72Q6GZ72_HUMAN
Constitutive androstane receptor SV...
NR1I3
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C0H5Y2C0H5Y2_HUMAN
NR1I3 protein
NR1I3 hCG_1766510
274Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GZ69Q6GZ69_HUMAN
Constitutive androstane receptor SV...
NR1I3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GZ70Q6GZ70_HUMAN
Constitutive androstane receptor SV...
NR1I3
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018344133V → G1 Publication1
Natural variantiVAR_080264247F → S Found in a patient with Kleefstra syndrome; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs398122411Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0437301 – 35MASRE…CKGFF → MLPKRS in isoform 4, isoform 5, isoform 6, isoform 9, isoform 10, isoform 11 and isoform 15. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_043144232 – 274VSPTV…ALFSP → APYLT in isoform 3. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_043731232 – 274Missing in isoform 4, isoform 7, isoform 14 and isoform 15. 3 PublicationsAdd BLAST43
Alternative sequenceiVSP_055180232 – 235Missing in isoform 13. 1 Publication4
Alternative sequenceiVSP_010634233 – 236Missing in isoform 2, isoform 5, isoform 6, isoform 9 and isoform 10. 3 Publications4
Alternative sequenceiVSP_043732274P → PAPYLT in isoform 6, isoform 8, isoform 10, isoform 11 and isoform 13. 2 Publications1
Alternative sequenceiVSP_046144311 – 352FLYAK…QEICS → SPGTPWIHWSGKMLGPKIGP GSKGAQWLQ in isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 15. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z30425 mRNA Translation: CAA83016.1
AY572806 mRNA Translation: AAT47159.1
AY572808 mRNA Translation: AAT47161.1
AY572810 mRNA Translation: AAT47163.1
AY572811 mRNA Translation: AAT47164.1
AY572812 mRNA Translation: AAT47165.1
AY572813 mRNA Translation: AAT47166.1
AY572816 mRNA Translation: AAT47169.1
AY572817 mRNA Translation: AAT47170.1
AY572818 mRNA Translation: AAT47171.1
AY572819 mRNA Translation: AAT47172.1
AY572827 mRNA Translation: AAT47180.1
DQ022681 mRNA Translation: AAY56401.1
HQ692838 mRNA Translation: ADZ17349.1
HQ692839 mRNA Translation: ADZ17350.1
HQ692840 mRNA Translation: ADZ17351.1
HQ692841 mRNA Translation: ADZ17352.1
AL590714 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52608.1
CH471121 Genomic DNA Translation: EAW52609.1
BC069626 mRNA Translation: AAH69626.1
BC121120 mRNA Translation: AAI21121.1
BC121121 mRNA Translation: AAI21122.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1228.1 [Q14994-2]
CCDS41427.1 [Q14994-6]
CCDS41428.1 [Q14994-3]
CCDS41429.1 [Q14994-8]
CCDS41430.1 [Q14994-1]
CCDS44260.1 [Q14994-12]
CCDS44261.1 [Q14994-13]
CCDS44262.1 [Q14994-7]
CCDS53405.1 [Q14994-15]
CCDS53406.1 [Q14994-16]
CCDS53407.1 [Q14994-4]
CCDS53408.1 [Q14994-9]
CCDS53409.1 [Q14994-5]
CCDS53410.1 [Q14994-10]
CCDS53411.1 [Q14994-11]

Protein sequence database of the Protein Information Resource

More...PIRi		A56197

NCBI Reference Sequences

More...RefSeqi		NP_001070937.1, NM_001077469.2 [Q14994-13]
NP_001070938.1, NM_001077470.2 [Q14994-4]
NP_001070939.1, NM_001077471.2 [Q14994-7]
NP_001070940.1, NM_001077472.2 [Q14994-6]
NP_001070941.1, NM_001077473.2 [Q14994-11]
NP_001070942.1, NM_001077474.2 [Q14994-15]
NP_001070943.1, NM_001077475.2 [Q14994-16]
NP_001070944.1, NM_001077476.2 [Q14994-10]
NP_001070945.1, NM_001077477.2 [Q14994-9]
NP_001070946.1, NM_001077478.2 [Q14994-12]
NP_001070947.1, NM_001077479.2 [Q14994-5]
NP_001070948.1, NM_001077480.2 [Q14994-1]
NP_001070949.1, NM_001077481.2 [Q14994-3]
NP_001070950.1, NM_001077482.2 [Q14994-8]
NP_005113.1, NM_005122.4 [Q14994-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000367979; ENSP00000356958; ENSG00000143257 [Q14994-8]
ENST00000367980; ENSP00000356959; ENSG00000143257 [Q14994-8]
ENST00000367981; ENSP00000356960; ENSG00000143257 [Q14994-6]
ENST00000367982; ENSP00000356961; ENSG00000143257 [Q14994-1]
ENST00000367983; ENSP00000356962; ENSG00000143257 [Q14994-2]
ENST00000367984; ENSP00000356963; ENSG00000143257 [Q14994-7]
ENST00000367985; ENSP00000356965; ENSG00000143257 [Q14994-3]
ENST00000412844; ENSP00000399361; ENSG00000143257 [Q14994-11]
ENST00000428574; ENSP00000412672; ENSG00000143257 [Q14994-13]
ENST00000437437; ENSP00000407446; ENSG00000143257 [Q14994-9]
ENST00000442691; ENSP00000406493; ENSG00000143257 [Q14994-12]
ENST00000504010; ENSP00000424345; ENSG00000143257 [Q14994-4]
ENST00000505005; ENSP00000424934; ENSG00000143257 [Q14994-15]
ENST00000508740; ENSP00000423666; ENSG00000143257 [Q14994-10]
ENST00000511676; ENSP00000427175; ENSG00000143257 [Q14994-5]
ENST00000512372; ENSP00000425417; ENSG00000143257 [Q14994-16]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9970

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9970

UCSC genome browser

More...UCSCi		uc001fzf.4, human [Q14994-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z30425 mRNA Translation: CAA83016.1
AY572806 mRNA Translation: AAT47159.1
AY572808 mRNA Translation: AAT47161.1
AY572810 mRNA Translation: AAT47163.1
AY572811 mRNA Translation: AAT47164.1
AY572812 mRNA Translation: AAT47165.1
AY572813 mRNA Translation: AAT47166.1
AY572816 mRNA Translation: AAT47169.1
AY572817 mRNA Translation: AAT47170.1
AY572818 mRNA Translation: AAT47171.1
AY572819 mRNA Translation: AAT47172.1
AY572827 mRNA Translation: AAT47180.1
DQ022681 mRNA Translation: AAY56401.1
HQ692838 mRNA Translation: ADZ17349.1
HQ692839 mRNA Translation: ADZ17350.1
HQ692840 mRNA Translation: ADZ17351.1
HQ692841 mRNA Translation: ADZ17352.1
AL590714 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52608.1
CH471121 Genomic DNA Translation: EAW52609.1
BC069626 mRNA Translation: AAH69626.1
BC121120 mRNA Translation: AAI21121.1
BC121121 mRNA Translation: AAI21122.1
CCDSiCCDS1228.1 [Q14994-2]
CCDS41427.1 [Q14994-6]
CCDS41428.1 [Q14994-3]
CCDS41429.1 [Q14994-8]
CCDS41430.1 [Q14994-1]
CCDS44260.1 [Q14994-12]
CCDS44261.1 [Q14994-13]
CCDS44262.1 [Q14994-7]
CCDS53405.1 [Q14994-15]
CCDS53406.1 [Q14994-16]
CCDS53407.1 [Q14994-4]
CCDS53408.1 [Q14994-9]
CCDS53409.1 [Q14994-5]
CCDS53410.1 [Q14994-10]
CCDS53411.1 [Q14994-11]
PIRiA56197
RefSeqiNP_001070937.1, NM_001077469.2 [Q14994-13]
NP_001070938.1, NM_001077470.2 [Q14994-4]
NP_001070939.1, NM_001077471.2 [Q14994-7]
NP_001070940.1, NM_001077472.2 [Q14994-6]
NP_001070941.1, NM_001077473.2 [Q14994-11]
NP_001070942.1, NM_001077474.2 [Q14994-15]
NP_001070943.1, NM_001077475.2 [Q14994-16]
NP_001070944.1, NM_001077476.2 [Q14994-10]
NP_001070945.1, NM_001077477.2 [Q14994-9]
NP_001070946.1, NM_001077478.2 [Q14994-12]
NP_001070947.1, NM_001077479.2 [Q14994-5]
NP_001070948.1, NM_001077480.2 [Q14994-1]
NP_001070949.1, NM_001077481.2 [Q14994-3]
NP_001070950.1, NM_001077482.2 [Q14994-8]
NP_005113.1, NM_005122.4 [Q14994-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XV9X-ray2.70B/D103-352[»]
1XVPX-ray2.60B/D103-352[»]
SMRiQ14994
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115295, 36 interactors
IntActiQ14994, 20 interactors
STRINGi9606.ENSP00000356959

Chemistry databases

BindingDBiQ14994
ChEMBLiCHEMBL5503
DrugBankiDB01889, 16,17-Androstene-3-Ol
DB07557, 3,20-Pregnanedione
DB01076, Atorvastatin
DB04540, Cholesterol
DB00366, Doxylamine
DB07931, Hexestrol
DB01026, Ketoconazole
DB00836, Loperamide
DB00737, Meclizine
DB01620, Pheniramine
DB04824, Phenolphthalein
DB01708, Prasterone
DB02709, Resveratrol
DB08604, Triclosan
DrugCentraliQ14994
GuidetoPHARMACOLOGYi607
SwissLipidsiSLP:000001585

PTM databases

iPTMnetiQ14994
PhosphoSitePlusiQ14994

Genetic variation databases

BioMutaiNR1I3
DMDMi49066046

Proteomic databases

jPOSTiQ14994
PaxDbiQ14994
PRIDEiQ14994
ProteomicsDBi19162
19340
19747
20322
20436
20507
20570
60278 [Q14994-1]
60279 [Q14994-2]
60280 [Q14994-3]
60281 [Q14994-4]
60282 [Q14994-5]
60283 [Q14994-6]
60284 [Q14994-7]
62261

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		20508, 447 antibodies

The DNASU plasmid repository

More...DNASUi		9970

Genome annotation databases

EnsembliENST00000367979; ENSP00000356958; ENSG00000143257 [Q14994-8]
ENST00000367980; ENSP00000356959; ENSG00000143257 [Q14994-8]
ENST00000367981; ENSP00000356960; ENSG00000143257 [Q14994-6]
ENST00000367982; ENSP00000356961; ENSG00000143257 [Q14994-1]
ENST00000367983; ENSP00000356962; ENSG00000143257 [Q14994-2]
ENST00000367984; ENSP00000356963; ENSG00000143257 [Q14994-7]
ENST00000367985; ENSP00000356965; ENSG00000143257 [Q14994-3]
ENST00000412844; ENSP00000399361; ENSG00000143257 [Q14994-11]
ENST00000428574; ENSP00000412672; ENSG00000143257 [Q14994-13]
ENST00000437437; ENSP00000407446; ENSG00000143257 [Q14994-9]
ENST00000442691; ENSP00000406493; ENSG00000143257 [Q14994-12]
ENST00000504010; ENSP00000424345; ENSG00000143257 [Q14994-4]
ENST00000505005; ENSP00000424934; ENSG00000143257 [Q14994-15]
ENST00000508740; ENSP00000423666; ENSG00000143257 [Q14994-10]
ENST00000511676; ENSP00000427175; ENSG00000143257 [Q14994-5]
ENST00000512372; ENSP00000425417; ENSG00000143257 [Q14994-16]
GeneIDi9970
KEGGihsa:9970
UCSCiuc001fzf.4, human [Q14994-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9970
DisGeNETi9970

GeneCards: human genes, protein and diseases

More...GeneCardsi		NR1I3
HGNCiHGNC:7969, NR1I3
HPAiENSG00000143257, Tissue enriched (liver)
MIMi603881, gene
neXtProtiNX_Q14994
OpenTargetsiENSG00000143257
PharmGKBiPA391
VEuPathDBiHostDB:ENSG00000143257.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3575, Eukaryota
GeneTreeiENSGT00940000160641
HOGENOMiCLU_007368_12_0_1
InParanoidiQ14994
OMAiLPLLMHF
OrthoDBi297114at2759
PhylomeDBiQ14994
TreeFamiTF316304

Enzyme and pathway databases

PathwayCommonsiQ14994
ReactomeiR-HSA-383280, Nuclear Receptor transcription pathway
SignaLinkiQ14994
SIGNORiQ14994

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9970, 8 hits in 1006 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NR1I3, human
EvolutionaryTraceiQ14994

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Constitutive_androstane_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9970
PharosiQ14994, Tchem

Protein Ontology

More...PROi		PR:Q14994
RNActiQ14994, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000143257, Expressed in right lobe of liver and 124 other tissues
ExpressionAtlasiQ14994, baseline and differential
GenevisibleiQ14994, HS

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
IDEALiIID00475
InterProiView protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001728, ThyrH_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
PR00546, THYROIDHORMR
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNR1I3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14994
Secondary accession number(s): E9PB75
, E9PC13, E9PDU3, E9PGH6, E9PH10, E9PHC8, E9PHN4, F1D8Q0, F1D8Q1, Q0VAC9, Q4U0F0, Q5VTW5, Q5VTW6, Q6GZ68, Q6GZ76, Q6GZ77, Q6GZ78, Q6GZ79, Q6GZ82, Q6GZ83, Q6GZ84, Q6GZ85, Q6GZ87, Q6GZ89
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 21, 2004
Last modified: April 7, 2021
This is version 204 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again