Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor subfamily 1 group I member 3

Gene

NR1I3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi8 – 83Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri11 – 31NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri47 – 71NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-383280 Nuclear Receptor transcription pathway
SignaLinkiQ14994
SIGNORiQ14994

Chemistry databases

SwissLipidsiSLP:000001585

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor subfamily 1 group I member 3
Alternative name(s):
Constitutive activator of retinoid response
Short name:
Constitutive active response
Constitutive androstane receptor
Short name:
CAR
Orphan nuclear receptor MB67
Gene namesi
Name:NR1I3
Synonyms:CAR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143257.11
HGNCiHGNC:7969 NR1I3
MIMi603881 gene
neXtProtiNX_Q14994

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9970
OpenTargetsiENSG00000143257
PharmGKBiPA391

Chemistry databases

ChEMBLiCHEMBL5503
DrugBankiDB01708 Prasterone
GuidetoPHARMACOLOGYi607

Polymorphism and mutation databases

BioMutaiNR1I3
DMDMi49066046

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000535521 – 352Nuclear receptor subfamily 1 group I member 3Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei38Phosphothreonine; by PKC1 Publication1

Post-translational modificationi

Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ14994
PRIDEiQ14994
ProteomicsDBi60278
60279 [Q14994-2]
60280 [Q14994-3]
60281 [Q14994-4]
60282 [Q14994-5]
60283 [Q14994-6]
60284 [Q14994-7]

PTM databases

iPTMnetiQ14994
PhosphoSitePlusiQ14994

Expressioni

Tissue specificityi

Predominantly expressed in liver.

Inductioni

By dexamethasone.

Gene expression databases

BgeeiENSG00000143257 Expressed in 98 organ(s), highest expression level in right lobe of liver
CleanExiHS_NR1I3
ExpressionAtlasiQ14994 baseline and differential
GenevisibleiQ14994 HS

Organism-specific databases

HPAiHPA051365

Interactioni

Subunit structurei

Interacts with ECT2 (By similarity). Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115295, 31 interactors
IntActiQ14994, 7 interactors
STRINGi9606.ENSP00000356958

Chemistry databases

BindingDBiQ14994

Structurei

Secondary structure

1352
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14994
SMRiQ14994
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14994

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini109 – 352NR LBDPROSITE-ProRule annotationAdd BLAST244

Domaini

Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri11 – 31NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri47 – 71NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00870000136372
HOGENOMiHOG000220844
HOVERGENiHBG108655
InParanoidiQ14994
KOiK08541
OMAiGLTCPFA
OrthoDBiEOG091G0DMU
PhylomeDBiQ14994
TreeFamiTF316304

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001728 ThyrH_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00546 THYROIDHORMR
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

Sequences (15+)i

Sequence statusi: Complete.

This entry describes 15 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 15 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14994-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASREDELRN CVVCGDQATG YHFNALTCEG CKGFFRRTVS KSIGPTCPFA
60 70 80 90 100
GSCEVSKTQR RHCPACRLQK CLDAGMRKDM ILSAEALALR RAKQAQRRAQ
110 120 130 140 150
QTPVQLSKEQ EELIRTLLGA HTRHMGTMFE QFVQFRPPAH LFIHHQPLPT
160 170 180 190 200
LAPVLPLVTH FADINTFMVL QVIKFTKDLP VFRSLPIEDQ ISLLKGAAVE
210 220 230 240 250
ICHIVLNTTF CLQTQNFLCG PLRYTIEDGA RVSPTVGFQV EFLELLFHFH
260 270 280 290 300
GTLRKLQLQE PEYVLLAAMA LFSPDRPGVT QRDEIDQLQE EMALTLQSYI
310 320 330 340 350
KGQQRRPRDR FLYAKLLGLL AELRSINEAY GYQIQHIQGL SAMMPLLQEI

CS
Length:352
Mass (Da):39,942
Last modified:June 21, 2004 - v2
Checksum:i73B060FE4950D519
GO
Isoform 2 (identifier: Q14994-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-236: Missing.

Show »
Length:348
Mass (Da):39,558
Checksum:i92EAAD07D7DCB9DA
GO
Isoform 3 (identifier: Q14994-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: VSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSP → APYLT

Show »
Length:314
Mass (Da):35,588
Checksum:iEE9F842EF2B19A2E
GO
Isoform 4 (identifier: Q14994-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.

Show »
Length:280
Mass (Da):31,900
Checksum:i7F3BFA4F60A16FB1
GO
Isoform 5 (identifier: Q14994-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.

Show »
Length:319
Mass (Da):36,416
Checksum:iC41CFFC814E96E46
GO
Isoform 6 (identifier: Q14994-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT

Show »
Length:324
Mass (Da):36,961
Checksum:i32245F1A8C523B1E
GO
Isoform 7 (identifier: Q14994-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.

Show »
Length:309
Mass (Da):35,043
Checksum:i47BDCF4FC3777574
GO
Isoform 8 (identifier: Q14994-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     274-274: P → PAPYLT

Show »
Length:357
Mass (Da):40,488
Checksum:i1AF956D0A2759781
GO
Isoform 9 (identifier: Q14994-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:306
Mass (Da):34,778
Checksum:iEA8397560E3A2AC1
GO
Isoform 10 (identifier: Q14994-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:311
Mass (Da):35,323
Checksum:i88A1BD387DDFFF8B
GO
Isoform 11 (identifier: Q14994-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:315
Mass (Da):35,708
Checksum:iA90FF3A0E39D1305
GO
Isoform 12 (identifier: Q14994-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:339
Mass (Da):38,304
Checksum:iAEDAD58E1ECA2D6E
GO
Isoform 13 (identifier: Q14994-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-235: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:340
Mass (Da):38,466
Checksum:iC13708F49C3A2145
GO
Isoform 14 (identifier: Q14994-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:296
Mass (Da):33,405
Checksum:i3D8FC1261A54C270
GO
Isoform 15 (identifier: Q14994-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:267
Mass (Da):30,262
Checksum:i97343837A4943EFE
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z8R7B7Z8R7_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
238Annotation score:
E9PCF2E9PCF2_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
297Annotation score:
C0H5Y2C0H5Y2_HUMAN
NR1I3 protein
NR1I3 hCG_1766510
274Annotation score:
D6REZ7D6REZ7_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I3
273Annotation score:
Q6GZ72Q6GZ72_HUMAN
Constitutive androstane receptor SV...
NR1I3
147Annotation score:
Q6GZ69Q6GZ69_HUMAN
Constitutive androstane receptor SV...
NR1I3
119Annotation score:
Q6GZ70Q6GZ70_HUMAN
Constitutive androstane receptor SV...
NR1I3
118Annotation score:
Q6GZ81Q6GZ81_HUMAN
Constitutive androstane receptor SV...
NR1I3
90Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018344133V → G1 Publication1
Natural variantiVAR_080264247F → S Found in a patient with Kleefstra syndrome; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs398122411EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0437301 – 35MASRE…CKGFF → MLPKRS in isoform 4, isoform 5, isoform 6, isoform 9, isoform 10, isoform 11 and isoform 15. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_043144232 – 274VSPTV…ALFSP → APYLT in isoform 3. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_043731232 – 274Missing in isoform 4, isoform 7, isoform 14 and isoform 15. 3 PublicationsAdd BLAST43
Alternative sequenceiVSP_055180232 – 235Missing in isoform 13. 1 Publication4
Alternative sequenceiVSP_010634233 – 236Missing in isoform 2, isoform 5, isoform 6, isoform 9 and isoform 10. 3 Publications4
Alternative sequenceiVSP_043732274P → PAPYLT in isoform 6, isoform 8, isoform 10, isoform 11 and isoform 13. 2 Publications1
Alternative sequenceiVSP_046144311 – 352FLYAK…QEICS → SPGTPWIHWSGKMLGPKIGP GSKGAQWLQ in isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 15. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z30425 mRNA Translation: CAA83016.1
AY572806 mRNA Translation: AAT47159.1
AY572808 mRNA Translation: AAT47161.1
AY572810 mRNA Translation: AAT47163.1
AY572811 mRNA Translation: AAT47164.1
AY572812 mRNA Translation: AAT47165.1
AY572813 mRNA Translation: AAT47166.1
AY572816 mRNA Translation: AAT47169.1
AY572817 mRNA Translation: AAT47170.1
AY572818 mRNA Translation: AAT47171.1
AY572819 mRNA Translation: AAT47172.1
AY572827 mRNA Translation: AAT47180.1
DQ022681 mRNA Translation: AAY56401.1
HQ692838 mRNA Translation: ADZ17349.1
HQ692839 mRNA Translation: ADZ17350.1
HQ692840 mRNA Translation: ADZ17351.1
HQ692841 mRNA Translation: ADZ17352.1
AL590714 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52608.1
CH471121 Genomic DNA Translation: EAW52609.1
BC069626 mRNA Translation: AAH69626.1
BC121120 mRNA Translation: AAI21121.1
BC121121 mRNA Translation: AAI21122.1
CCDSiCCDS1228.1 [Q14994-2]
CCDS41427.1 [Q14994-6]
CCDS41428.1 [Q14994-3]
CCDS41429.1 [Q14994-8]
CCDS41430.1 [Q14994-1]
CCDS44260.1 [Q14994-12]
CCDS44261.1 [Q14994-13]
CCDS44262.1 [Q14994-7]
CCDS53405.1 [Q14994-15]
CCDS53406.1 [Q14994-16]
CCDS53407.1 [Q14994-4]
CCDS53408.1 [Q14994-9]
CCDS53409.1 [Q14994-5]
CCDS53410.1 [Q14994-10]
CCDS53411.1 [Q14994-11]
PIRiA56197
RefSeqiNP_001070937.1, NM_001077469.2 [Q14994-13]
NP_001070938.1, NM_001077470.2 [Q14994-4]
NP_001070939.1, NM_001077471.2 [Q14994-7]
NP_001070940.1, NM_001077472.2 [Q14994-6]
NP_001070941.1, NM_001077473.2 [Q14994-11]
NP_001070942.1, NM_001077474.2 [Q14994-15]
NP_001070943.1, NM_001077475.2 [Q14994-16]
NP_001070944.1, NM_001077476.2 [Q14994-10]
NP_001070945.1, NM_001077477.2 [Q14994-9]
NP_001070946.1, NM_001077478.2 [Q14994-12]
NP_001070947.1, NM_001077479.2 [Q14994-5]
NP_001070948.1, NM_001077480.2 [Q14994-1]
NP_001070949.1, NM_001077481.2 [Q14994-3]
NP_001070950.1, NM_001077482.2 [Q14994-8]
NP_005113.1, NM_005122.4 [Q14994-2]
UniGeneiHs.349642

Genome annotation databases

EnsembliENST00000367979; ENSP00000356958; ENSG00000143257 [Q14994-8]
ENST00000367980; ENSP00000356959; ENSG00000143257 [Q14994-8]
ENST00000367981; ENSP00000356960; ENSG00000143257 [Q14994-6]
ENST00000367982; ENSP00000356961; ENSG00000143257 [Q14994-1]
ENST00000367983; ENSP00000356962; ENSG00000143257 [Q14994-2]
ENST00000367984; ENSP00000356963; ENSG00000143257 [Q14994-7]
ENST00000367985; ENSP00000356965; ENSG00000143257 [Q14994-3]
ENST00000412844; ENSP00000399361; ENSG00000143257 [Q14994-11]
ENST00000428574; ENSP00000412672; ENSG00000143257 [Q14994-13]
ENST00000437437; ENSP00000407446; ENSG00000143257 [Q14994-9]
ENST00000442691; ENSP00000406493; ENSG00000143257 [Q14994-12]
ENST00000504010; ENSP00000424345; ENSG00000143257 [Q14994-4]
ENST00000505005; ENSP00000424934; ENSG00000143257 [Q14994-15]
ENST00000508740; ENSP00000423666; ENSG00000143257 [Q14994-10]
ENST00000511676; ENSP00000427175; ENSG00000143257 [Q14994-5]
ENST00000512372; ENSP00000425417; ENSG00000143257 [Q14994-16]
GeneIDi9970
KEGGihsa:9970
UCSCiuc001fzf.4 human [Q14994-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z30425 mRNA Translation: CAA83016.1
AY572806 mRNA Translation: AAT47159.1
AY572808 mRNA Translation: AAT47161.1
AY572810 mRNA Translation: AAT47163.1
AY572811 mRNA Translation: AAT47164.1
AY572812 mRNA Translation: AAT47165.1
AY572813 mRNA Translation: AAT47166.1
AY572816 mRNA Translation: AAT47169.1
AY572817 mRNA Translation: AAT47170.1
AY572818 mRNA Translation: AAT47171.1
AY572819 mRNA Translation: AAT47172.1
AY572827 mRNA Translation: AAT47180.1
DQ022681 mRNA Translation: AAY56401.1
HQ692838 mRNA Translation: ADZ17349.1
HQ692839 mRNA Translation: ADZ17350.1
HQ692840 mRNA Translation: ADZ17351.1
HQ692841 mRNA Translation: ADZ17352.1
AL590714 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52608.1
CH471121 Genomic DNA Translation: EAW52609.1
BC069626 mRNA Translation: AAH69626.1
BC121120 mRNA Translation: AAI21121.1
BC121121 mRNA Translation: AAI21122.1
CCDSiCCDS1228.1 [Q14994-2]
CCDS41427.1 [Q14994-6]
CCDS41428.1 [Q14994-3]
CCDS41429.1 [Q14994-8]
CCDS41430.1 [Q14994-1]
CCDS44260.1 [Q14994-12]
CCDS44261.1 [Q14994-13]
CCDS44262.1 [Q14994-7]
CCDS53405.1 [Q14994-15]
CCDS53406.1 [Q14994-16]
CCDS53407.1 [Q14994-4]
CCDS53408.1 [Q14994-9]
CCDS53409.1 [Q14994-5]
CCDS53410.1 [Q14994-10]
CCDS53411.1 [Q14994-11]
PIRiA56197
RefSeqiNP_001070937.1, NM_001077469.2 [Q14994-13]
NP_001070938.1, NM_001077470.2 [Q14994-4]
NP_001070939.1, NM_001077471.2 [Q14994-7]
NP_001070940.1, NM_001077472.2 [Q14994-6]
NP_001070941.1, NM_001077473.2 [Q14994-11]
NP_001070942.1, NM_001077474.2 [Q14994-15]
NP_001070943.1, NM_001077475.2 [Q14994-16]
NP_001070944.1, NM_001077476.2 [Q14994-10]
NP_001070945.1, NM_001077477.2 [Q14994-9]
NP_001070946.1, NM_001077478.2 [Q14994-12]
NP_001070947.1, NM_001077479.2 [Q14994-5]
NP_001070948.1, NM_001077480.2 [Q14994-1]
NP_001070949.1, NM_001077481.2 [Q14994-3]
NP_001070950.1, NM_001077482.2 [Q14994-8]
NP_005113.1, NM_005122.4 [Q14994-2]
UniGeneiHs.349642

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XV9X-ray2.70B/D103-352[»]
1XVPX-ray2.60B/D103-352[»]
ProteinModelPortaliQ14994
SMRiQ14994
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115295, 31 interactors
IntActiQ14994, 7 interactors
STRINGi9606.ENSP00000356958

Chemistry databases

BindingDBiQ14994
ChEMBLiCHEMBL5503
DrugBankiDB01708 Prasterone
GuidetoPHARMACOLOGYi607
SwissLipidsiSLP:000001585

PTM databases

iPTMnetiQ14994
PhosphoSitePlusiQ14994

Polymorphism and mutation databases

BioMutaiNR1I3
DMDMi49066046

Proteomic databases

PaxDbiQ14994
PRIDEiQ14994
ProteomicsDBi60278
60279 [Q14994-2]
60280 [Q14994-3]
60281 [Q14994-4]
60282 [Q14994-5]
60283 [Q14994-6]
60284 [Q14994-7]

Protocols and materials databases

DNASUi9970
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367979; ENSP00000356958; ENSG00000143257 [Q14994-8]
ENST00000367980; ENSP00000356959; ENSG00000143257 [Q14994-8]
ENST00000367981; ENSP00000356960; ENSG00000143257 [Q14994-6]
ENST00000367982; ENSP00000356961; ENSG00000143257 [Q14994-1]
ENST00000367983; ENSP00000356962; ENSG00000143257 [Q14994-2]
ENST00000367984; ENSP00000356963; ENSG00000143257 [Q14994-7]
ENST00000367985; ENSP00000356965; ENSG00000143257 [Q14994-3]
ENST00000412844; ENSP00000399361; ENSG00000143257 [Q14994-11]
ENST00000428574; ENSP00000412672; ENSG00000143257 [Q14994-13]
ENST00000437437; ENSP00000407446; ENSG00000143257 [Q14994-9]
ENST00000442691; ENSP00000406493; ENSG00000143257 [Q14994-12]
ENST00000504010; ENSP00000424345; ENSG00000143257 [Q14994-4]
ENST00000505005; ENSP00000424934; ENSG00000143257 [Q14994-15]
ENST00000508740; ENSP00000423666; ENSG00000143257 [Q14994-10]
ENST00000511676; ENSP00000427175; ENSG00000143257 [Q14994-5]
ENST00000512372; ENSP00000425417; ENSG00000143257 [Q14994-16]
GeneIDi9970
KEGGihsa:9970
UCSCiuc001fzf.4 human [Q14994-1]

Organism-specific databases

CTDi9970
DisGeNETi9970
EuPathDBiHostDB:ENSG00000143257.11
GeneCardsiNR1I3
HGNCiHGNC:7969 NR1I3
HPAiHPA051365
MIMi603881 gene
neXtProtiNX_Q14994
OpenTargetsiENSG00000143257
PharmGKBiPA391
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
GeneTreeiENSGT00870000136372
HOGENOMiHOG000220844
HOVERGENiHBG108655
InParanoidiQ14994
KOiK08541
OMAiGLTCPFA
OrthoDBiEOG091G0DMU
PhylomeDBiQ14994
TreeFamiTF316304

Enzyme and pathway databases

ReactomeiR-HSA-383280 Nuclear Receptor transcription pathway
SignaLinkiQ14994
SIGNORiQ14994

Miscellaneous databases

EvolutionaryTraceiQ14994
GeneWikiiConstitutive_androstane_receptor
GenomeRNAii9970
PROiPR:Q14994
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143257 Expressed in 98 organ(s), highest expression level in right lobe of liver
CleanExiHS_NR1I3
ExpressionAtlasiQ14994 baseline and differential
GenevisibleiQ14994 HS

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001728 ThyrH_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
PR00546 THYROIDHORMR
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNR1I3_HUMAN
AccessioniPrimary (citable) accession number: Q14994
Secondary accession number(s): E9PB75
, E9PC13, E9PDU3, E9PGH6, E9PH10, E9PHC8, E9PHN4, F1D8Q0, F1D8Q1, Q0VAC9, Q4U0F0, Q5VTW5, Q5VTW6, Q6GZ68, Q6GZ76, Q6GZ77, Q6GZ78, Q6GZ79, Q6GZ82, Q6GZ83, Q6GZ84, Q6GZ85, Q6GZ87, Q6GZ89
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 21, 2004
Last modified: November 7, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again