Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (08 May 2019)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Nuclear factor of activated T-cells, cytoplasmic 4

Gene

NFATC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ca2+-regulated transcription factor that is involved in several processes, including the development and function of the immune, cardiovascular, musculoskeletal, and nervous systems (PubMed:7749981, PubMed:11514544, PubMed:11997522, PubMed:17875713, PubMed:17213202, PubMed:18668201, PubMed:25663301). Involved in T-cell activation, stimulating the transcription of cytokine genes, including that of IL2 and IL4 (PubMed:7749981, PubMed:18668201, PubMed:18347059). Along with NFATC3, involved in embryonic heart development. Involved in mitochondrial energy metabolism required for cardiac morphogenesis and function (By similarity). Transactivates many genes involved in the cardiovascular system, including AGTR2, NPPB/BNP (in synergy with GATA4), NPPA/ANP/ANF and MYH7/beta-MHC (By similarity). Involved in the regulation of adult hippocampal neurogenesis. Involved in BDNF-driven pro-survival signaling in hippocampal adult-born neurons. Involved in the formation of long-term spatial memory and long-term potentiation (By similarity). In cochlear nucleus neurons, may play a role in deafferentation-induced apoptosis during the developmental critical period, when auditory neurons depend on afferent input for survival (By similarity). Binds to and activates the BACE1/Beta-secretase 1 promoter, hence may regulate the proteolytic processing of the amyloid precursor protein (APP) (PubMed:25663301). Plays a role in adipocyte differentiation (PubMed:11997522). May be involved in myoblast differentiation into myotubes (PubMed:17213202). Binds the consensus DNA sequence 5'-GGAAAAT-3' (Probable). In the presence of CREBBP, activates TNF transcription (PubMed:11514544). Binds to PPARG gene promoter and regulates its activity (PubMed:11997522). Binds to PPARG and REG3G gene promoters (By similarity).By similarityCurated8 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Transcriptional activity may be repressed by ESR1 and ESR2.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi430 – 4378

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding
Biological processDifferentiation, Transcription, Transcription regulation

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q14934

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 4
Short name:
NF-ATc4
Short name:
NFATc4
Alternative name(s):
T-cell transcription factor NFAT32 Publications
Short name:
NF-AT31 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFATC4
Synonyms:NFAT34 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7778 NFATC4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602699 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14934

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi168S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-170. 1 Publication1
Mutagenesisi170S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-168. 1 Publication1
Mutagenesisi213S → A: Marked decrease in phosphorylation by MAPK8 or MAPK9. Complete loss of phosphorylation by MAPK8 or MAPK9, but no effect on MAPK8/9-binding; when associated with A-217. Decreased transcriptional activity; when associated with A-217. 1 Publication1
Mutagenesisi217S → A: Marked decrease in phosphorylation by MAPK8 or MAPK9. Complete loss of phosphorylation by MAPK8 or MAPK9, but no effect on MAPK8/9-binding; when associated with A-213. Decreased transcriptional activity; when associated with A-213. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
4776

Open Targets

More...
OpenTargetsi
ENSG00000100968

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31584

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NFATC4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274090

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002051821 – 902Nuclear factor of activated T-cells, cytoplasmic 4Add BLAST902

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei168Phosphoserine; by MAPK7 and MAPK142 Publications1
Modified residuei170Phosphoserine; by MAPK7 and MAPK142 Publications1
Modified residuei213Phosphoserine; by MAPK8 and MAPK91 Publication1
Modified residuei217Phosphoserine; by MAPK8 and MAPK91 Publication1
Modified residuei289Phosphoserine; by RPS6KA31 Publication1
Modified residuei344Phosphoserine; by RPS6KA31 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki689Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by NFATC-kinases; dephosphorylated by calcineurin/PPP3CA. Phosphorylated on Ser-168 and Ser-170 by MTOR, IRAK1, MAPK7/ERK5 and MAPK14/p38, on Ser-213 and Ser-217 by MAPK8/JNK1 and MAPK9/JNK2, and on Ser-289 and Ser-344 by RPS6KA3 (PubMed:11997522, PubMed:17875713, PubMed:17213202, PubMed:18347059). Phosphorylated by GSK3B (PubMed:18347059). Phosphorylation by GSK3B markedly increases NFATC4 ubiquitination (By similarity). Phosphorylation at Ser-168 and Ser-170 is stimulated by UV irradiation (PubMed:18347059). Phosphorylation determines subcellular location: the hyperphosphorylated protein is cytosolic, while the dephosphorylated form is targeted to the nucleus.By similarity4 Publications
Ubiquitinated, leading to degradation by the proteasome. Ubiquitination may be stimulated by GSK3B-dependent phosphorylation. Polyubiquitin linkage mainly occurs through 'Lys-48'.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14934

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14934

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14934

PeptideAtlas

More...
PeptideAtlasi
Q14934

PRoteomics IDEntifications database

More...
PRIDEi
Q14934

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60223
60224 [Q14934-10]
60225 [Q14934-11]
60226 [Q14934-12]
60227 [Q14934-13]
60228 [Q14934-14]
60229 [Q14934-15]
60230 [Q14934-16]
60231 [Q14934-17]
60232 [Q14934-18]
60233 [Q14934-19]
60234 [Q14934-2]
60235 [Q14934-20]
60236 [Q14934-21]
60237 [Q14934-22]
60238 [Q14934-23]
60239 [Q14934-24]
60240 [Q14934-3]
60241 [Q14934-4]
60242 [Q14934-5]
60243 [Q14934-6]
60244 [Q14934-7]
60245 [Q14934-8]
60246 [Q14934-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14934

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14934

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with high levels in placenta, lung, kidney, testis and ovary (PubMed:18675896). Weakly expressed in spleen and thymus (PubMed:18675896). In the hippocampus, expressed in the granular layer of the dentate gyrus, in the pyramidal neurons of CA3 region, and in the hippocampal fissure (PubMed:18675896). Expressed in the heart (at protein level) (PubMed:12370307).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100968 Expressed in 219 organ(s), highest expression level in right ovary

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14934 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14934 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB032859
HPA031641
HPA076526

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other NFAT proteins, such as NFATC3, or members of the activating protein-1 (AP-1) family and MAF can also bind the complex. NFAT proteins can bind DNA as monomers or dimers (PubMed:7749981). Interacts with CREBBP; this interaction potentiates transcription activation (PubMed:11514544). Interacts with MAPK8/JNK1 and MAPK9/JNK2 (PubMed:17875713). Interacts with GATA4 (via the second Zn finger) (By similarity). Interacts (via N-terminus) with IRAK1 (via C-terminus) (PubMed:18691762). Interacts with RPS6KA3 (PubMed:17213202). Interacts with HOMER1, HOMER2 and HOMER3; this interaction competes with calcineurin/PPP3CA-binding and hence prevents NFATC4 dephosphorylation and activation (PubMed:18218901). Interacts with ESR1 and ESR2; this interaction decreases NFATC4 transcriptional activity (PubMed:18668201). Interacts with MTOR and MAPK7/ERK5 (PubMed:18347059).By similarity8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
UBCP0CG483EBI-3905796,EBI-3390054

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110849, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q14934, 12 interactors

Molecular INTeraction database

More...
MINTi
Q14934

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000388910

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1902
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14934

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14934

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati213 – 229SP 1Add BLAST17
Repeati277 – 293SP 2; approximateAdd BLAST17
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini401 – 582RHDPROSITE-ProRule annotationAdd BLAST182
Domaini586 – 683IPT/TIGAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni114 – 119Calcineurin-binding6
Regioni213 – 2932 approximate SP repeatsAdd BLAST81

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi268 – 270Nuclear localization signal3
Motifi672 – 674Nuclear localization signal3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi41 – 327Pro-richAdd BLAST287
Compositional biasi717 – 836Pro-richAdd BLAST120

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Rel similarity domain (RSD) or Rel homology domain (RHD) allows DNA-binding and cooperative interactions with AP-1 factors.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIAD Eukaryota
ENOG4111EMW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160923

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14934

KEGG Orthology (KO)

More...
KOi
K17334

Identification of Orthologs from Complete Genome Data

More...
OMAi
PWNLYGP

Database of Orthologous Groups

More...
OrthoDBi
95502at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14934

TreeFam database of animal gene trees

More...
TreeFami
TF326480

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit
2.60.40.340, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12533 PTHR12533, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01789 NUCFACTORATC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50254 REL_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (24+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 24 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 24 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14934-1) [UniParc]FASTAAdd to basket
Also known as: ID-IXL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAASCEDEE LEFKLVFGEE KEAPPLGAGG LGEELDSEDA PPCCRLALGE
60 70 80 90 100
PPPYGAAPIG IPRPPPPRPG MHSPPPRPAP SPGTWESQPA RSVRLGGPGG
110 120 130 140 150
GAGGAGGGRV LECPSIRITS ISPTPEPPAA LEDNPDAWGD GSPRDYPPPE
160 170 180 190 200
GFGGYREAGG QGGGAFFSPS PGSSSLSSWS FFSDASDEAA LYAACDEVES
210 220 230 240 250
ELNEAASRFG LGSPLPSPRA SPRPWTPEDP WSLYGPSPGG RGPEDSWLLL
260 270 280 290 300
SAPGPTPASP RPASPCGKRR YSSSGTPSSA SPALSRRGSL GEEGSEPPPP
310 320 330 340 350
PPLPLARDPG SPGPFDYVGA PPAESIPQKT RRTSSEQAVA LPRSEEPASC
360 370 380 390 400
NGKLPLGAEE SVAPPGGSRK EVAGMDYLAV PSPLAWSKAR IGGHSPIFRT
410 420 430 440 450
SALPPLDWPL PSQYEQLELR IEVQPRAHHR AHYETEGSRG AVKAAPGGHP
460 470 480 490 500
VVKLLGYSEK PLTLQMFIGT ADERNLRPHA FYQVHRITGK MVATASYEAV
510 520 530 540 550
VSGTKVLEMT LLPENNMAAN IDCAGILKLR NSDIELRKGE TDIGRKNTRV
560 570 580 590 600
RLVFRVHVPQ GGGKVVSVQA ASVPIECSQR SAQELPQVEA YSPSACSVRG
610 620 630 640 650
GEELVLTGSN FLPDSKVVFI ERGPDGKLQW EEEATVNRLQ SNEVTLTLTV
660 670 680 690 700
PEYSNKRVSR PVQVYFYVSN GRRKRSPTQS FRFLPVICKE EPLPDSSLRG
710 720 730 740 750
FPSASATPFG TDMDFSPPRP PYPSYPHEDP ACETPYLSEG FGYGMPPLYP
760 770 780 790 800
QTGPPPSYRP GLRMFPETRG TTGCAQPPAV SFLPRPFPSD PYGGRGSSFS
810 820 830 840 850
LGLPFSPPAP FRPPPLPASP PLEGPFPSQS DVHPLPAEGY NKVGPGYGPG
860 870 880 890 900
EGAPEQEKSR GGYSSGFRDS VPIQGITLEE VSEIIGRDLS GFPAPPGEEP

PA
Length:902
Mass (Da):95,449
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAE94C5D1325D24D7
GO
Isoform 2 (identifier: Q14934-2) [UniParc]FASTAAdd to basket
Also known as: IA-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM

Show »
Length:965
Mass (Da):101,680
Checksum:i977A42276D24A2DD
GO
Isoform 3 (identifier: Q14934-3) [UniParc]FASTAAdd to basket
Also known as: IA-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:964
Mass (Da):101,513
Checksum:i91DDEA6EACD24AD1
GO
Isoform 4 (identifier: Q14934-4) [UniParc]FASTAAdd to basket
Also known as: IC-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM

Show »
Length:934
Mass (Da):98,436
Checksum:iE72E379E8F1087A2
GO
Isoform 5 (identifier: Q14934-5) [UniParc]FASTAAdd to basket
Also known as: IC-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:933
Mass (Da):98,269
Checksum:iB5A8538C98F73584
GO
Isoform 6 (identifier: Q14934-6) [UniParc]FASTAAdd to basket
Also known as: IB-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM

Show »
Length:915
Mass (Da):96,662
Checksum:i36C042AAF575636D
GO
Isoform 7 (identifier: Q14934-7) [UniParc]FASTAAdd to basket
Also known as: IB-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:914
Mass (Da):96,495
Checksum:iCBDD67F6FD13FA0B
GO
Isoform 8 (identifier: Q14934-8) [UniParc]FASTAAdd to basket
Also known as: ID-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:901
Mass (Da):95,282
Checksum:i2F5A1C31D55440FA
GO
Isoform 9 (identifier: Q14934-9) [UniParc]FASTAAdd to basket
Also known as: IE-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS

Show »
Length:890
Mass (Da):94,146
Checksum:iCD0C3EF25B5761B6
GO
Isoform 10 (identifier: Q14934-10) [UniParc]FASTAAdd to basket
Also known as: IE-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:889
Mass (Da):93,978
Checksum:iE7A13F58DF1121B1
GO
Isoform 11 (identifier: Q14934-11) [UniParc]FASTAAdd to basket
Also known as: IA-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:857
Mass (Da):90,525
Checksum:iAA5ED1F6E0713077
GO
Isoform 12 (identifier: Q14934-12) [UniParc]FASTAAdd to basket
Also known as: IEi-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Note: Due to an intron retention.
Show »
Length:832
Mass (Da):88,270
Checksum:i22978126C7D764DB
GO
Isoform 13 (identifier: Q14934-13) [UniParc]FASTAAdd to basket
Also known as: IEi-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:831
Mass (Da):88,103
Checksum:iCC1EEBC45F144C10
GO
Isoform 14 (identifier: Q14934-14) [UniParc]FASTAAdd to basket
Also known as: IC-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:826
Mass (Da):87,282
Checksum:i4BF3996D8C2BA62C
GO
Isoform 15 (identifier: Q14934-15) [UniParc]FASTAAdd to basket
Also known as: IB-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     773-880: Missing.

Show »
Length:807
Mass (Da):85,508
Checksum:iF9035684E3A5FE7E
GO
Isoform 16 (identifier: Q14934-16) [UniParc]FASTAAdd to basket
Also known as: ID-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     773-880: Missing.

Show »
Length:794
Mass (Da):84,294
Checksum:i8378E0D0BB0888D2
GO
Isoform 17 (identifier: Q14934-17) [UniParc]FASTAAdd to basket
Also known as: IE-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     773-880: Missing.

Show »
Length:782
Mass (Da):82,991
Checksum:i4B73A89F510DC96E
GO
Isoform 18 (identifier: Q14934-18) [UniParc]FASTAAdd to basket
Also known as: IEi-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     773-880: Missing.

Note: Due to an intron retention.
Show »
Length:724
Mass (Da):77,115
Checksum:iE589F6754CC1B54C
GO
Isoform 19 (identifier: Q14934-19) [UniParc]FASTAAdd to basket
Also known as: IV-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.

Show »
Length:437
Mass (Da):47,373
Checksum:iEEA72B2EDFA7E67A
GO
Isoform 20 (identifier: Q14934-20) [UniParc]FASTAAdd to basket
Also known as: IV-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:436
Mass (Da):47,206
Checksum:iACB4E3DC2F96ED8B
GO
Isoform 21 (identifier: Q14934-21) [UniParc]FASTAAdd to basket
Also known as: IV-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     773-880: Missing.

Show »
Length:329
Mass (Da):36,219
Checksum:i043037F5F05D38C5
GO
Isoform 22 (identifier: Q14934-22) [UniParc]FASTAAdd to basket
Also known as: VI-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.

Show »
Length:190
Mass (Da):20,104
Checksum:i3B4512C612A69FDF
GO
Isoform 23 (identifier: Q14934-23) [UniParc]FASTAAdd to basket
Also known as: VI-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:189
Mass (Da):19,937
Checksum:iCE8D0B112EEF4803
GO
Isoform 24 (identifier: Q14934-24) [UniParc]FASTAAdd to basket
Also known as: VI-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     773-880: Missing.

Show »
Length:82
Mass (Da):8,950
Checksum:iDC673A88B52B383F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V4U6G3V4U6_HUMAN
Nuclear factor of-activated T-cells...
NFATC4
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V5H0G3V5H0_HUMAN
Nuclear factor of-activated T-cells...
NFATC4
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4K1G3V4K1_HUMAN
Nuclear factor of-activated T-cells...
NFATC4
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti359E → K in BAG56726 (PubMed:14702039).Curated1
Sequence conflicti646L → P in BAG63617 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_046985160G → A2 PublicationsCorresponds to variant dbSNP:rs2229309Ensembl.1
Natural variantiVAR_046986246S → N. Corresponds to variant dbSNP:rs2228231Ensembl.1
Natural variantiVAR_046987800S → P2 PublicationsCorresponds to variant dbSNP:rs7149586Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0366971 – 712Missing in isoform 22, isoform 23 and isoform 24. 1 PublicationAdd BLAST712
Alternative sequenceiVSP_0366981 – 465Missing in isoform 19, isoform 20 and isoform 21. 1 PublicationAdd BLAST465
Alternative sequenceiVSP_0366991 – 70Missing in isoform 12, isoform 13 and isoform 18. 2 PublicationsAdd BLAST70
Alternative sequenceiVSP_0367001 – 32MGAAS…AGGLG → MPASISSIFPGPTLLLSCGS in isoform 9, isoform 10 and isoform 17. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0367011M → MITTLPSLLPASLASISHRV TNLPSNSLSHNPGLSKPDFP GNSSPGLPSSSSPGRDLGAP AGSM in isoform 2, isoform 3 and isoform 11. 1 Publication1
Alternative sequenceiVSP_0367021M → MADGGADSAAQRLPEGPGRV APGRDLGAPAGSM in isoform 4, isoform 5 and isoform 14. 1 Publication1
Alternative sequenceiVSP_0367031M → MLSGRDLGAPAGSM in isoform 6, isoform 7 and isoform 15. 1 Publication1
Alternative sequenceiVSP_036704773 – 880Missing in isoform 11, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 21 and isoform 24. 2 PublicationsAdd BLAST108
Alternative sequenceiVSP_036705881 – 902VSEII…EEPPA → GGCGTGGCECECVQEIALHV C in isoform 3, isoform 5, isoform 7, isoform 8, isoform 10, isoform 13, isoform 20 and isoform 23. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L41066 mRNA Translation: AAA79175.1
EU887632 mRNA Translation: ACG55652.1
EU887633 mRNA Translation: ACG55653.1
EU887634 mRNA Translation: ACG55654.1
EU887635 mRNA Translation: ACG55655.1
EU887636 mRNA Translation: ACG55656.1
EU887637 mRNA Translation: ACG55657.1
EU887638 mRNA Translation: ACG55658.1
EU887639 mRNA Translation: ACG55659.1
EU887640 mRNA Translation: ACG55660.1
EU887641 mRNA Translation: ACG55661.1
EU887642 mRNA Translation: ACG55662.1
EU887643 mRNA Translation: ACG55663.1
EU887644 mRNA Translation: ACG55664.1
EU887645 mRNA Translation: ACG55665.1
EU887646 mRNA Translation: ACG55666.1
EU887647 mRNA Translation: ACG55667.1
EU887648 mRNA Translation: ACG55668.1
EU887649 mRNA Translation: ACG55669.1
EU887650 mRNA Translation: ACG55670.1
EU887651 mRNA Translation: ACG55671.1
EU887652 mRNA Translation: ACG55672.1
EU887653 mRNA Translation: ACG55673.1
EU887654 mRNA Translation: ACG55674.1
EU887655 mRNA Translation: ACG55675.1
AK293185 mRNA Translation: BAG56726.1
AK302271 mRNA Translation: BAG63617.1
BC008857 mRNA Translation: AAH08857.2
BC053855 mRNA Translation: AAH53855.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45089.1 [Q14934-3]
CCDS55909.1 [Q14934-11]
CCDS55910.1 [Q14934-16]
CCDS55911.1 [Q14934-12]
CCDS73625.1 [Q14934-10]
CCDS86379.1 [Q14934-17]
CCDS86380.1 [Q14934-9]
CCDS9629.1 [Q14934-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129494.1, NM_001136022.2 [Q14934-3]
NP_001185894.1, NM_001198965.1 [Q14934-16]
NP_001185895.1, NM_001198966.2 [Q14934-12]
NP_001185896.1, NM_001198967.2 [Q14934-11]
NP_001275731.1, NM_001288802.1 [Q14934-10]
NP_001306972.1, NM_001320043.1 [Q14934-2]
NP_004545.2, NM_004554.4 [Q14934-1]
XP_011535099.1, XM_011536797.2
XP_011535101.1, XM_011536799.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000250373; ENSP00000250373; ENSG00000100968 [Q14934-1]
ENST00000413692; ENSP00000388910; ENSG00000100968 [Q14934-3]
ENST00000422617; ENSP00000396788; ENSG00000100968 [Q14934-10]
ENST00000424781; ENSP00000388668; ENSG00000100968 [Q14934-7]
ENST00000539237; ENSP00000439350; ENSG00000100968 [Q14934-5]
ENST00000553469; ENSP00000451502; ENSG00000100968 [Q14934-14]
ENST00000553708; ENSP00000450590; ENSG00000100968 [Q14934-8]
ENST00000553879; ENSP00000452349; ENSG00000100968 [Q14934-12]
ENST00000554050; ENSP00000451151; ENSG00000100968 [Q14934-16]
ENST00000554344; ENSP00000450469; ENSG00000100968 [Q14934-12]
ENST00000554473; ENSP00000450810; ENSG00000100968 [Q14934-21]
ENST00000554591; ENSP00000452039; ENSG00000100968 [Q14934-11]
ENST00000554661; ENSP00000450733; ENSG00000100968 [Q14934-18]
ENST00000554966; ENSP00000450644; ENSG00000100968 [Q14934-15]
ENST00000555167; ENSP00000451395; ENSG00000100968 [Q14934-20]
ENST00000555393; ENSP00000451801; ENSG00000100968 [Q14934-23]
ENST00000555453; ENSP00000450686; ENSG00000100968 [Q14934-9]
ENST00000555590; ENSP00000451224; ENSG00000100968 [Q14934-6]
ENST00000555802; ENSP00000451590; ENSG00000100968 [Q14934-22]
ENST00000556169; ENSP00000451454; ENSG00000100968 [Q14934-17]
ENST00000556279; ENSP00000452270; ENSG00000100968 [Q14934-4]
ENST00000556759; ENSP00000451183; ENSG00000100968 [Q14934-19]
ENST00000557451; ENSP00000451284; ENSG00000100968 [Q14934-13]
ENST00000557767; ENSP00000451496; ENSG00000100968 [Q14934-24]
ENST00000642182; ENSP00000495011; ENSG00000285485 [Q14934-18]
ENST00000642302; ENSP00000494405; ENSG00000285485 [Q14934-1]
ENST00000642423; ENSP00000495052; ENSG00000285485 [Q14934-14]
ENST00000642571; ENSP00000493808; ENSG00000285485 [Q14934-4]
ENST00000642650; ENSP00000495758; ENSG00000285485 [Q14934-13]
ENST00000643468; ENSP00000494577; ENSG00000285485 [Q14934-12]
ENST00000643679; ENSP00000493557; ENSG00000285485 [Q14934-8]
ENST00000643941; ENSP00000493733; ENSG00000285485 [Q14934-9]
ENST00000644025; ENSP00000494705; ENSG00000285485 [Q14934-16]
ENST00000644166; ENSP00000496192; ENSG00000285485 [Q14934-7]
ENST00000644182; ENSP00000495766; ENSG00000285485 [Q14934-12]
ENST00000644376; ENSP00000493885; ENSG00000285485 [Q14934-3]
ENST00000644583; ENSP00000496733; ENSG00000285485 [Q14934-23]
ENST00000644758; ENSP00000495684; ENSG00000285485 [Q14934-6]
ENST00000645116; ENSP00000493851; ENSG00000285485 [Q14934-5]
ENST00000645397; ENSP00000493943; ENSG00000285485 [Q14934-19]
ENST00000645587; ENSP00000495213; ENSG00000285485 [Q14934-21]
ENST00000645795; ENSP00000495926; ENSG00000285485 [Q14934-20]
ENST00000646023; ENSP00000494993; ENSG00000285485 [Q14934-10]
ENST00000646364; ENSP00000496579; ENSG00000285485 [Q14934-15]
ENST00000646650; ENSP00000496777; ENSG00000285485 [Q14934-11]
ENST00000646652; ENSP00000496108; ENSG00000285485 [Q14934-24]
ENST00000647017; ENSP00000496558; ENSG00000285485 [Q14934-22]
ENST00000647345; ENSP00000493614; ENSG00000285485 [Q14934-17]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4776

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4776

UCSC genome browser

More...
UCSCi
uc001wpc.5 human [Q14934-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41066 mRNA Translation: AAA79175.1
EU887632 mRNA Translation: ACG55652.1
EU887633 mRNA Translation: ACG55653.1
EU887634 mRNA Translation: ACG55654.1
EU887635 mRNA Translation: ACG55655.1
EU887636 mRNA Translation: ACG55656.1
EU887637 mRNA Translation: ACG55657.1
EU887638 mRNA Translation: ACG55658.1
EU887639 mRNA Translation: ACG55659.1
EU887640 mRNA Translation: ACG55660.1
EU887641 mRNA Translation: ACG55661.1
EU887642 mRNA Translation: ACG55662.1
EU887643 mRNA Translation: ACG55663.1
EU887644 mRNA Translation: ACG55664.1
EU887645 mRNA Translation: ACG55665.1
EU887646 mRNA Translation: ACG55666.1
EU887647 mRNA Translation: ACG55667.1
EU887648 mRNA Translation: ACG55668.1
EU887649 mRNA Translation: ACG55669.1
EU887650 mRNA Translation: ACG55670.1
EU887651 mRNA Translation: ACG55671.1
EU887652 mRNA Translation: ACG55672.1
EU887653 mRNA Translation: ACG55673.1
EU887654 mRNA Translation: ACG55674.1
EU887655 mRNA Translation: ACG55675.1
AK293185 mRNA Translation: BAG56726.1
AK302271 mRNA Translation: BAG63617.1
BC008857 mRNA Translation: AAH08857.2
BC053855 mRNA Translation: AAH53855.1
CCDSiCCDS45089.1 [Q14934-3]
CCDS55909.1 [Q14934-11]
CCDS55910.1 [Q14934-16]
CCDS55911.1 [Q14934-12]
CCDS73625.1 [Q14934-10]
CCDS86379.1 [Q14934-17]
CCDS86380.1 [Q14934-9]
CCDS9629.1 [Q14934-1]
RefSeqiNP_001129494.1, NM_001136022.2 [Q14934-3]
NP_001185894.1, NM_001198965.1 [Q14934-16]
NP_001185895.1, NM_001198966.2 [Q14934-12]
NP_001185896.1, NM_001198967.2 [Q14934-11]
NP_001275731.1, NM_001288802.1 [Q14934-10]
NP_001306972.1, NM_001320043.1 [Q14934-2]
NP_004545.2, NM_004554.4 [Q14934-1]
XP_011535099.1, XM_011536797.2
XP_011535101.1, XM_011536799.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRPNMR-A585-691[»]
SMRiQ14934
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110849, 16 interactors
IntActiQ14934, 12 interactors
MINTiQ14934
STRINGi9606.ENSP00000388910

PTM databases

iPTMnetiQ14934
PhosphoSitePlusiQ14934

Polymorphism and mutation databases

BioMutaiNFATC4
DMDMi215274090

Proteomic databases

jPOSTiQ14934
MaxQBiQ14934
PaxDbiQ14934
PeptideAtlasiQ14934
PRIDEiQ14934
ProteomicsDBi60223
60224 [Q14934-10]
60225 [Q14934-11]
60226 [Q14934-12]
60227 [Q14934-13]
60228 [Q14934-14]
60229 [Q14934-15]
60230 [Q14934-16]
60231 [Q14934-17]
60232 [Q14934-18]
60233 [Q14934-19]
60234 [Q14934-2]
60235 [Q14934-20]
60236 [Q14934-21]
60237 [Q14934-22]
60238 [Q14934-23]
60239 [Q14934-24]
60240 [Q14934-3]
60241 [Q14934-4]
60242 [Q14934-5]
60243 [Q14934-6]
60244 [Q14934-7]
60245 [Q14934-8]
60246 [Q14934-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4776
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250373; ENSP00000250373; ENSG00000100968 [Q14934-1]
ENST00000413692; ENSP00000388910; ENSG00000100968 [Q14934-3]
ENST00000422617; ENSP00000396788; ENSG00000100968 [Q14934-10]
ENST00000424781; ENSP00000388668; ENSG00000100968 [Q14934-7]
ENST00000539237; ENSP00000439350; ENSG00000100968 [Q14934-5]
ENST00000553469; ENSP00000451502; ENSG00000100968 [Q14934-14]
ENST00000553708; ENSP00000450590; ENSG00000100968 [Q14934-8]
ENST00000553879; ENSP00000452349; ENSG00000100968 [Q14934-12]
ENST00000554050; ENSP00000451151; ENSG00000100968 [Q14934-16]
ENST00000554344; ENSP00000450469; ENSG00000100968 [Q14934-12]
ENST00000554473; ENSP00000450810; ENSG00000100968 [Q14934-21]
ENST00000554591; ENSP00000452039; ENSG00000100968 [Q14934-11]
ENST00000554661; ENSP00000450733; ENSG00000100968 [Q14934-18]
ENST00000554966; ENSP00000450644; ENSG00000100968 [Q14934-15]
ENST00000555167; ENSP00000451395; ENSG00000100968 [Q14934-20]
ENST00000555393; ENSP00000451801; ENSG00000100968 [Q14934-23]
ENST00000555453; ENSP00000450686; ENSG00000100968 [Q14934-9]
ENST00000555590; ENSP00000451224; ENSG00000100968 [Q14934-6]
ENST00000555802; ENSP00000451590; ENSG00000100968 [Q14934-22]
ENST00000556169; ENSP00000451454; ENSG00000100968 [Q14934-17]
ENST00000556279; ENSP00000452270; ENSG00000100968 [Q14934-4]
ENST00000556759; ENSP00000451183; ENSG00000100968 [Q14934-19]
ENST00000557451; ENSP00000451284; ENSG00000100968 [Q14934-13]
ENST00000557767; ENSP00000451496; ENSG00000100968 [Q14934-24]
ENST00000642182; ENSP00000495011; ENSG00000285485 [Q14934-18]
ENST00000642302; ENSP00000494405; ENSG00000285485 [Q14934-1]
ENST00000642423; ENSP00000495052; ENSG00000285485 [Q14934-14]
ENST00000642571; ENSP00000493808; ENSG00000285485 [Q14934-4]
ENST00000642650; ENSP00000495758; ENSG00000285485 [Q14934-13]
ENST00000643468; ENSP00000494577; ENSG00000285485 [Q14934-12]
ENST00000643679; ENSP00000493557; ENSG00000285485 [Q14934-8]
ENST00000643941; ENSP00000493733; ENSG00000285485 [Q14934-9]
ENST00000644025; ENSP00000494705; ENSG00000285485 [Q14934-16]
ENST00000644166; ENSP00000496192; ENSG00000285485 [Q14934-7]
ENST00000644182; ENSP00000495766; ENSG00000285485 [Q14934-12]
ENST00000644376; ENSP00000493885; ENSG00000285485 [Q14934-3]
ENST00000644583; ENSP00000496733; ENSG00000285485 [Q14934-23]
ENST00000644758; ENSP00000495684; ENSG00000285485 [Q14934-6]
ENST00000645116; ENSP00000493851; ENSG00000285485 [Q14934-5]
ENST00000645397; ENSP00000493943; ENSG00000285485 [Q14934-19]
ENST00000645587; ENSP00000495213; ENSG00000285485 [Q14934-21]
ENST00000645795; ENSP00000495926; ENSG00000285485 [Q14934-20]
ENST00000646023; ENSP00000494993; ENSG00000285485 [Q14934-10]
ENST00000646364; ENSP00000496579; ENSG00000285485 [Q14934-15]
ENST00000646650; ENSP00000496777; ENSG00000285485 [Q14934-11]
ENST00000646652; ENSP00000496108; ENSG00000285485 [Q14934-24]
ENST00000647017; ENSP00000496558; ENSG00000285485 [Q14934-22]
ENST00000647345; ENSP00000493614; ENSG00000285485 [Q14934-17]
GeneIDi4776
KEGGihsa:4776
UCSCiuc001wpc.5 human [Q14934-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4776
DisGeNETi4776

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NFATC4
HGNCiHGNC:7778 NFATC4
HPAiCAB032859
HPA031641
HPA076526
MIMi602699 gene
neXtProtiNX_Q14934
OpenTargetsiENSG00000100968
PharmGKBiPA31584

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIAD Eukaryota
ENOG4111EMW LUCA
GeneTreeiENSGT00940000160923
InParanoidiQ14934
KOiK17334
OMAiPWNLYGP
OrthoDBi95502at2759
PhylomeDBiQ14934
TreeFamiTF326480

Enzyme and pathway databases

SIGNORiQ14934

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NFATC4 human
EvolutionaryTraceiQ14934

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NFATC4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4776

Protein Ontology

More...
PROi
PR:Q14934

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100968 Expressed in 219 organ(s), highest expression level in right ovary
ExpressionAtlasiQ14934 baseline and differential
GenevisibleiQ14934 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
2.60.40.340, 1 hit
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR008366 NFAT
IPR008967 p53-like_TF_DNA-bd
IPR032397 RHD_dimer
IPR011539 RHD_DNA_bind_dom
IPR037059 RHD_DNA_bind_dom_sf
PANTHERiPTHR12533 PTHR12533, 1 hit
PfamiView protein in Pfam
PF16179 RHD_dimer, 1 hit
PF00554 RHD_DNA_bind, 1 hit
PRINTSiPR01789 NUCFACTORATC
SMARTiView protein in SMART
SM00429 IPT, 1 hit
SUPFAMiSSF49417 SSF49417, 1 hit
SSF81296 SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS50254 REL_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFAC4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14934
Secondary accession number(s): B4DDG5
, B4DY55, B5B2U7, B5B2U8, B5B2U9, B5B2V0, B5B2V1, B5B2V2, B5B2V3, B5B2V4, B5B2V5, B5B2V7, B5B2V8, B5B2V9, B5B2W0, B5B2W1, B5B2W2, B5B2W3, B5B2W4, B5B2W5, B5B2W6, B5B2W7, B5B2W8, B5B2W9, B5B2X0, Q7Z598, Q96H68
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 25, 2008
Last modified: May 8, 2019
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again