Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin reductase 1

Gene

PTGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.By similarity

Catalytic activityi

A n-alkanal + NAD(P)+ = an alk-2-enal + NAD(P)H.
11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)+ = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13-dienoate + NAD(P)H.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei178NADP1 Publication1
Binding sitei193NADP1 Publication1
Binding sitei217NADP1 Publication1
Binding sitei321NADP1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi152 – 155NADP1 Publication4
Nucleotide bindingi239 – 245NADP1 Publication7
Nucleotide bindingi270 – 272NADP1 Publication3

GO - Molecular functioni

GO - Biological processi

  • leukotriene metabolic process Source: UniProtKB
  • response to antineoplastic agent Source: Ensembl

Keywordsi

Molecular functionOxidoreductase
LigandNADP

Enzyme and pathway databases

ReactomeiR-HSA-2142691 Synthesis of Leukotrienes (LT) and Eoxins (EX)
R-HSA-2142700 Synthesis of Lipoxins (LX)

Chemistry databases

SwissLipidsiSLP:000001629

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin reductase 1 (EC:1.3.1.-)
Short name:
PRG-1
Alternative name(s):
15-oxoprostaglandin 13-reductase (EC:1.3.1.48)
NADP-dependent leukotriene B4 12-hydroxydehydrogenase (EC:1.3.1.74)
Gene namesi
Name:PTGR1
Synonyms:LTB4DH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000106853.16
HGNCiHGNC:18429 PTGR1
MIMi601274 gene
neXtProtiNX_Q14914

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi22949
OpenTargetsiENSG00000106853
PharmGKBiPA162400322

Chemistry databases

DrugBankiDB03461 2'-Monophosphoadenosine 5'-Diphosphoribose
DB04066 Para-Coumaric Acid

Polymorphism and mutation databases

BioMutaiPTGR1
DMDMi23503081

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002180651 – 329Prostaglandin reductase 1Add BLAST329

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei18PhosphothreonineCombined sources1
Modified residuei20PhosphoserineCombined sources1
Modified residuei178N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ14914
MaxQBiQ14914
PaxDbiQ14914
PeptideAtlasiQ14914
PRIDEiQ14914
ProteomicsDBi60217
TopDownProteomicsiQ14914-1 [Q14914-1]

PTM databases

iPTMnetiQ14914
PhosphoSitePlusiQ14914

Expressioni

Tissue specificityi

High expression in the kidney, liver, and intestine but not in leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000106853 Expressed in 200 organ(s), highest expression level in jejunal mucosa
CleanExiHS_PTGR1
ExpressionAtlasiQ14914 baseline and differential
GenevisibleiQ14914 HS

Organism-specific databases

HPAiHPA036724

Interactioni

Subunit structurei

Monomer or homodimer.By similarity

Protein-protein interaction databases

BioGridi116604, 14 interactors
IntActiQ14914, 2 interactors
STRINGi9606.ENSP00000311572

Structurei

Secondary structure

1329
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14914
SMRiQ14914
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14914

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi250 – 257Pro-rich8

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1196 Eukaryota
COG2130 LUCA
GeneTreeiENSGT00390000009335
HOGENOMiHOG000294663
HOVERGENiHBG055024
InParanoidiQ14914
KOiK13948
OMAiRMNDSKS
OrthoDBiEOG091G0F5B
PhylomeDBiQ14914
TreeFamiTF324201

Family and domain databases

CDDicd08294 leukotriene_B4_DH_like, 1 hit
InterProiView protein in InterPro
IPR013149 ADH_C
IPR011032 GroES-like_sf
IPR036291 NAD(P)-bd_dom_sf
IPR020843 PKS_ER
IPR014190 PTGR1
PfamiView protein in Pfam
PF00107 ADH_zinc_N, 1 hit
SMARTiView protein in SMART
SM00829 PKS_ER, 1 hit
SUPFAMiSSF50129 SSF50129, 2 hits
SSF51735 SSF51735, 1 hit
TIGRFAMsiTIGR02825 B4_12hDH, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14914-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVRTKTWTLK KHFVGYPTNS DFELKTAELP PLKNGEVLLE ALFLTVDPYM
60 70 80 90 100
RVAAKRLKEG DTMMGQQVAK VVESKNVALP KGTIVLASPG WTTHSISDGK
110 120 130 140 150
DLEKLLTEWP DTIPLSLALG TVGMPGLTAY FGLLEICGVK GGETVMVNAA
160 170 180 190 200
AGAVGSVVGQ IAKLKGCKVV GAVGSDEKVA YLQKLGFDVV FNYKTVESLE
210 220 230 240 250
ETLKKASPDG YDCYFDNVGG EFSNTVIGQM KKFGRIAICG AISTYNRTGP
260 270 280 290 300
LPPGPPPEIV IYQELRMEAF VVYRWQGDAR QKALKDLLKW VLEGKIQYKE
310 320
YIIEGFENMP AAFMGMLKGD NLGKTIVKA
Length:329
Mass (Da):35,870
Last modified:September 19, 2002 - v2
Checksum:iE121ADB7C5BD9CF8
GO
Isoform 2 (identifier: Q14914-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-329: GKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA → IKRENEED

Note: No experimental confirmation available.
Show »
Length:301
Mass (Da):32,895
Checksum:iBD24D01FD752BE62
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z3J9F2Z3J9_HUMAN
Prostaglandin reductase 1
PTGR1
118Annotation score:
F6XGT7F6XGT7_HUMAN
Prostaglandin reductase 1
PTGR1
73Annotation score:
Q5JVP2Q5JVP2_HUMAN
Prostaglandin reductase 1
PTGR1
119Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti311A → R in BAA08382 (PubMed:8576264).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02311127A → S3 PublicationsCorresponds to variant dbSNP:rs1053959Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044652294 – 329GKIQY…TIVKA → IKRENEED in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289597 mRNA Translation: BAF82286.1
AK298379 mRNA Translation: BAG60615.1
AL135787 Genomic DNA No translation available.
AL159168 Genomic DNA No translation available.
CH471105 Genomic DNA Translation: EAW59074.1
BC035228 mRNA Translation: AAH35228.1
D49387 mRNA Translation: BAA08382.1
CCDSiCCDS55331.1 [Q14914-2]
CCDS6779.1 [Q14914-1]
RefSeqiNP_001139580.1, NM_001146108.1 [Q14914-1]
NP_001139581.1, NM_001146109.1 [Q14914-2]
NP_036344.2, NM_012212.3 [Q14914-1]
UniGeneiHs.584864

Genome annotation databases

EnsembliENST00000309195; ENSP00000311572; ENSG00000106853 [Q14914-1]
ENST00000407693; ENSP00000385763; ENSG00000106853 [Q14914-1]
ENST00000538962; ENSP00000440281; ENSG00000106853 [Q14914-2]
GeneIDi22949
KEGGihsa:22949
UCSCiuc004bfh.3 human [Q14914-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289597 mRNA Translation: BAF82286.1
AK298379 mRNA Translation: BAG60615.1
AL135787 Genomic DNA No translation available.
AL159168 Genomic DNA No translation available.
CH471105 Genomic DNA Translation: EAW59074.1
BC035228 mRNA Translation: AAH35228.1
D49387 mRNA Translation: BAA08382.1
CCDSiCCDS55331.1 [Q14914-2]
CCDS6779.1 [Q14914-1]
RefSeqiNP_001139580.1, NM_001146108.1 [Q14914-1]
NP_001139581.1, NM_001146109.1 [Q14914-2]
NP_036344.2, NM_012212.3 [Q14914-1]
UniGeneiHs.584864

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZSVX-ray2.30A/B/C/D4-329[»]
2Y05X-ray2.20A/B/C/D4-329[»]
ProteinModelPortaliQ14914
SMRiQ14914
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116604, 14 interactors
IntActiQ14914, 2 interactors
STRINGi9606.ENSP00000311572

Chemistry databases

DrugBankiDB03461 2'-Monophosphoadenosine 5'-Diphosphoribose
DB04066 Para-Coumaric Acid
SwissLipidsiSLP:000001629

PTM databases

iPTMnetiQ14914
PhosphoSitePlusiQ14914

Polymorphism and mutation databases

BioMutaiPTGR1
DMDMi23503081

Proteomic databases

EPDiQ14914
MaxQBiQ14914
PaxDbiQ14914
PeptideAtlasiQ14914
PRIDEiQ14914
ProteomicsDBi60217
TopDownProteomicsiQ14914-1 [Q14914-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309195; ENSP00000311572; ENSG00000106853 [Q14914-1]
ENST00000407693; ENSP00000385763; ENSG00000106853 [Q14914-1]
ENST00000538962; ENSP00000440281; ENSG00000106853 [Q14914-2]
GeneIDi22949
KEGGihsa:22949
UCSCiuc004bfh.3 human [Q14914-1]

Organism-specific databases

CTDi22949
DisGeNETi22949
EuPathDBiHostDB:ENSG00000106853.16
GeneCardsiPTGR1
H-InvDBiHIX0008283
HGNCiHGNC:18429 PTGR1
HPAiHPA036724
MIMi601274 gene
neXtProtiNX_Q14914
OpenTargetsiENSG00000106853
PharmGKBiPA162400322
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1196 Eukaryota
COG2130 LUCA
GeneTreeiENSGT00390000009335
HOGENOMiHOG000294663
HOVERGENiHBG055024
InParanoidiQ14914
KOiK13948
OMAiRMNDSKS
OrthoDBiEOG091G0F5B
PhylomeDBiQ14914
TreeFamiTF324201

Enzyme and pathway databases

ReactomeiR-HSA-2142691 Synthesis of Leukotrienes (LT) and Eoxins (EX)
R-HSA-2142700 Synthesis of Lipoxins (LX)

Miscellaneous databases

ChiTaRSiPTGR1 human
EvolutionaryTraceiQ14914
GenomeRNAii22949
PROiPR:Q14914
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106853 Expressed in 200 organ(s), highest expression level in jejunal mucosa
CleanExiHS_PTGR1
ExpressionAtlasiQ14914 baseline and differential
GenevisibleiQ14914 HS

Family and domain databases

CDDicd08294 leukotriene_B4_DH_like, 1 hit
InterProiView protein in InterPro
IPR013149 ADH_C
IPR011032 GroES-like_sf
IPR036291 NAD(P)-bd_dom_sf
IPR020843 PKS_ER
IPR014190 PTGR1
PfamiView protein in Pfam
PF00107 ADH_zinc_N, 1 hit
SMARTiView protein in SMART
SM00829 PKS_ER, 1 hit
SUPFAMiSSF50129 SSF50129, 2 hits
SSF51735 SSF51735, 1 hit
TIGRFAMsiTIGR02825 B4_12hDH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPTGR1_HUMAN
AccessioniPrimary (citable) accession number: Q14914
Secondary accession number(s): A8K0N2
, B4DPK3, F5GY50, Q8IYQ0, Q9H1X6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 19, 2002
Last modified: September 12, 2018
This is version 176 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again