Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 195 (02 Jun 2021)
Sequence version 2 (19 Sep 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Prostaglandin reductase 1

Gene

PTGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

NAD(P)H-dependent oxidoreductase involved in metabolic inactivation of pro- and anti-inflammatory eicosanoids: prostaglandins (PG), leukotrienes (LT) and lipoxins (LX) (PubMed:25619643).

Catalyzes with high efficiency the reduction of the 13,14 double bond of 15-oxoPGs, including 15-oxo-PGE1, 15-oxo-PGE2, 15-oxo-PGF1-alpha and 15-oxo-PGF2-alpha (PubMed:25619643).

Catalyzes with lower efficiency the oxidation of the hydroxyl group at C12 of LTB4 and its derivatives, converting them into biologically less active 12-oxo-LTB4 metabolites (PubMed:25619643) (By similarity).

Reduces 15-oxo-LXA4 to 13,14 dihydro-15-oxo-LXA4, enhancing neutrophil recruitment at the inflammatory site (By similarity).

May play a role in metabolic detoxification of alkenals and ketones. Reduces alpha,beta-unsaturated alkenals and ketones, particularly those with medium-chain length, showing highest affinity toward (2E)-decenal and (3E)-3-nonen-2-one (PubMed:25619643).

May inactivate 4-hydroxy-2-nonenal, a cytotoxic lipid constituent of oxidized low-density lipoprotein particles (By similarity).

By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=33 µM for (2E)-hexenal1 Publication
  2. KM=14 µM for (2E)-octenal1 Publication
  3. KM=6 µM for (2E)-decenal1 Publication
  4. KM=12 µM for (2E)-dodecenal1 Publication
  5. KM=12 µM for (3E)-3-buten-2-one1 Publication
  6. KM=7.3 µM for (3E)-3-penten-2-one1 Publication
  7. KM=6.5 µM for (3E)-3-nonen-2-one1 Publication
  8. KM=1.4 µM for 15-oxoprostaglandin E11 Publication
  9. KM=0.6 µM for 15-oxoprostaglandin E21 Publication
  10. KM=1.1 µM for 15-oxoprostaglandin F1alpha1 Publication
  11. KM=3.2 µM for 15-oxoprostaglandin F2alpha1 Publication
  12. KM=5.2 µM for leukotriene B41 Publication
  13. KM=14 µM for NADPH1 Publication
  14. KM=200 µM for NADH1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei178NADP1 Publication1
    Binding sitei193NADP1 Publication1
    Binding sitei217NADP1 Publication1
    Binding sitei321NADP1 Publication1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi152 – 155NADP1 Publication4
    Nucleotide bindingi239 – 245NADP1 Publication7
    Nucleotide bindingi270 – 272NADP1 Publication3

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    Biological processFatty acid metabolism, Lipid metabolism, Prostaglandin metabolism
    LigandNADP

    Enzyme and pathway databases

    Pathway Commons web resource for biological pathway data

    More...
    PathwayCommonsi
    Q14914

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-2142691, Synthesis of Leukotrienes (LT) and Eoxins (EX)
    R-HSA-2142700, Synthesis of Lipoxins (LX)

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000001629

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Prostaglandin reductase 11 Publication
    Short name:
    PRG-11 Publication
    Alternative name(s):
    15-oxoprostaglandin 13-reductaseBy similarity (EC:1.3.1.481 Publication)
    Dithiolethione-inducible gene 1 proteinBy similarity
    Short name:
    D3T-inducible gene 1 proteinBy similarity
    Short name:
    DIG-1By similarity
    Leukotriene B4 12-hydroxydehydrogenase1 Publication
    NAD(P)H-dependent alkenal/one oxidoreductase1 Publication (EC:1.3.1.741 Publication)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PTGR1
    Synonyms:LTB4DH
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:18429, PTGR1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    601274, gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q14914

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...
    VEuPathDBi
    HostDB:ENSG00000106853.16

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi56R → A: Markedly decreases the catalytic efficiency toward 15-oxoprostaglandin E2. 1 Publication1
    Mutagenesisi245Y → A or F: Markedly decreases the catalytic efficiency toward 15-oxoprostaglandin E2 and (3E)-3-nonen-2-one. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    22949

    Open Targets

    More...
    OpenTargetsi
    ENSG00000106853

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA162400322

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q14914, Tbio

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL4295822

    Drug and drug target database

    More...
    DrugBanki
    DB07177, (5E,13E)-11-HYDROXY-9,15-DIOXOPROSTA-5,13-DIEN-1-OIC ACID
    DB03461, Nicotinamide adenine dinucleotide phosphate
    DB04066, p-Coumaric acid

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    PTGR1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    23503081

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002180651 – 329Prostaglandin reductase 1Add BLAST329

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei18PhosphothreonineCombined sources1
    Modified residuei20PhosphoserineCombined sources1
    Modified residuei178N6-acetyllysineBy similarity1

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q14914

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q14914

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q14914

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q14914

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q14914

    PeptideAtlas

    More...
    PeptideAtlasi
    Q14914

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q14914

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    24627
    60217 [Q14914-1]

    Consortium for Top Down Proteomics

    More...
    TopDownProteomicsi
    Q14914-1 [Q14914-1]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q14914

    MetOSite database of methionine sulfoxide sites

    More...
    MetOSitei
    Q14914

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q14914

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    High expression in the kidney, liver, and intestine but not in leukocytes.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000106853, Expressed in jejunal mucosa and 213 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q14914, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q14914, HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    ENSG00000106853, Tissue enhanced (intestine, liver)

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer or homodimer.

    By similarity

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...
    BioGRIDi
    116604, 32 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q14914, 7 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000385763

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q14914, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1329
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q14914

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    Protein Data Bank in Europe - Knowledge Base

    More...
    PDBe-KBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q14914

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1196, Eukaryota

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000154810

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_026673_29_3_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q14914

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    KCRYAVE

    Database of Orthologous Groups

    More...
    OrthoDBi
    884151at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q14914

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF324201

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd08294, leukotriene_B4_DH_like, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR013149, ADH_C
    IPR041694, ADH_N_2
    IPR011032, GroES-like_sf
    IPR036291, NAD(P)-bd_dom_sf
    IPR020843, PKS_ER
    IPR014190, PTGR1

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF16884, ADH_N_2, 1 hit
    PF00107, ADH_zinc_N, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00829, PKS_ER, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF50129, SSF50129, 2 hits
    SSF51735, SSF51735, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR02825, B4_12hDH, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q14914-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MVRTKTWTLK KHFVGYPTNS DFELKTAELP PLKNGEVLLE ALFLTVDPYM
    60 70 80 90 100
    RVAAKRLKEG DTMMGQQVAK VVESKNVALP KGTIVLASPG WTTHSISDGK
    110 120 130 140 150
    DLEKLLTEWP DTIPLSLALG TVGMPGLTAY FGLLEICGVK GGETVMVNAA
    160 170 180 190 200
    AGAVGSVVGQ IAKLKGCKVV GAVGSDEKVA YLQKLGFDVV FNYKTVESLE
    210 220 230 240 250
    ETLKKASPDG YDCYFDNVGG EFSNTVIGQM KKFGRIAICG AISTYNRTGP
    260 270 280 290 300
    LPPGPPPEIV IYQELRMEAF VVYRWQGDAR QKALKDLLKW VLEGKIQYKE
    310 320
    YIIEGFENMP AAFMGMLKGD NLGKTIVKA
    Length:329
    Mass (Da):35,870
    Last modified:September 19, 2002 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE121ADB7C5BD9CF8
    GO
    Isoform 2 (identifier: Q14914-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         294-329: GKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA → IKRENEED

    Show »
    Length:301
    Mass (Da):32,895
    Checksum:iBD24D01FD752BE62
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    F2Z3J9F2Z3J9_HUMAN
    15-oxoprostaglandin 13-reductase
    PTGR1
    300Annotation score:

    Annotation score:5 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5JVP2Q5JVP2_HUMAN
    15-oxoprostaglandin 13-reductase
    PTGR1
    119Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F6XGT7F6XGT7_HUMAN
    15-oxoprostaglandin 13-reductase
    PTGR1
    73Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti311A → R in BAA08382 (PubMed:8576264).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02311127A → S3 PublicationsCorresponds to variant dbSNP:rs1053959Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044652294 – 329GKIQY…TIVKA → IKRENEED in isoform 2. 1 PublicationAdd BLAST36

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AK289597 mRNA Translation: BAF82286.1
    AK298379 mRNA Translation: BAG60615.1
    AL135787 Genomic DNA No translation available.
    AL159168 Genomic DNA No translation available.
    CH471105 Genomic DNA Translation: EAW59074.1
    BC035228 mRNA Translation: AAH35228.1
    D49387 mRNA Translation: BAA08382.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS55331.1 [Q14914-2]
    CCDS6779.1 [Q14914-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001139580.1, NM_001146108.1 [Q14914-1]
    NP_001139581.1, NM_001146109.1 [Q14914-2]
    NP_036344.2, NM_012212.3 [Q14914-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000309195; ENSP00000311572; ENSG00000106853 [Q14914-1]
    ENST00000407693; ENSP00000385763; ENSG00000106853 [Q14914-1]
    ENST00000538962; ENSP00000440281; ENSG00000106853 [Q14914-2]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    22949

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:22949

    UCSC genome browser

    More...
    UCSCi
    uc004bfh.3, human [Q14914-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AK289597 mRNA Translation: BAF82286.1
    AK298379 mRNA Translation: BAG60615.1
    AL135787 Genomic DNA No translation available.
    AL159168 Genomic DNA No translation available.
    CH471105 Genomic DNA Translation: EAW59074.1
    BC035228 mRNA Translation: AAH35228.1
    D49387 mRNA Translation: BAA08382.1
    CCDSiCCDS55331.1 [Q14914-2]
    CCDS6779.1 [Q14914-1]
    RefSeqiNP_001139580.1, NM_001146108.1 [Q14914-1]
    NP_001139581.1, NM_001146109.1 [Q14914-2]
    NP_036344.2, NM_012212.3 [Q14914-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    1ZSVX-ray2.30A/B/C/D4-329[»]
    2Y05X-ray2.20A/B/C/D4-329[»]
    SMRiQ14914
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi116604, 32 interactors
    IntActiQ14914, 7 interactors
    STRINGi9606.ENSP00000385763

    Chemistry databases

    ChEMBLiCHEMBL4295822
    DrugBankiDB07177, (5E,13E)-11-HYDROXY-9,15-DIOXOPROSTA-5,13-DIEN-1-OIC ACID
    DB03461, Nicotinamide adenine dinucleotide phosphate
    DB04066, p-Coumaric acid
    SwissLipidsiSLP:000001629

    PTM databases

    iPTMnetiQ14914
    MetOSiteiQ14914
    PhosphoSitePlusiQ14914

    Genetic variation databases

    BioMutaiPTGR1
    DMDMi23503081

    Proteomic databases

    EPDiQ14914
    jPOSTiQ14914
    MassIVEiQ14914
    MaxQBiQ14914
    PaxDbiQ14914
    PeptideAtlasiQ14914
    PRIDEiQ14914
    ProteomicsDBi24627
    60217 [Q14914-1]
    TopDownProteomicsiQ14914-1 [Q14914-1]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    29578, 214 antibodies

    The DNASU plasmid repository

    More...
    DNASUi
    22949

    Genome annotation databases

    EnsembliENST00000309195; ENSP00000311572; ENSG00000106853 [Q14914-1]
    ENST00000407693; ENSP00000385763; ENSG00000106853 [Q14914-1]
    ENST00000538962; ENSP00000440281; ENSG00000106853 [Q14914-2]
    GeneIDi22949
    KEGGihsa:22949
    UCSCiuc004bfh.3, human [Q14914-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    22949
    DisGeNETi22949

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    PTGR1
    HGNCiHGNC:18429, PTGR1
    HPAiENSG00000106853, Tissue enhanced (intestine, liver)
    MIMi601274, gene
    neXtProtiNX_Q14914
    OpenTargetsiENSG00000106853
    PharmGKBiPA162400322
    VEuPathDBiHostDB:ENSG00000106853.16

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1196, Eukaryota
    GeneTreeiENSGT00940000154810
    HOGENOMiCLU_026673_29_3_1
    InParanoidiQ14914
    OMAiKCRYAVE
    OrthoDBi884151at2759
    PhylomeDBiQ14914
    TreeFamiTF324201

    Enzyme and pathway databases

    PathwayCommonsiQ14914
    ReactomeiR-HSA-2142691, Synthesis of Leukotrienes (LT) and Eoxins (EX)
    R-HSA-2142700, Synthesis of Lipoxins (LX)

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...
    BioGRID-ORCSi
    22949, 6 hits in 989 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    PTGR1, human
    EvolutionaryTraceiQ14914

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    22949
    PharosiQ14914, Tbio

    Protein Ontology

    More...
    PROi
    PR:Q14914
    RNActiQ14914, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000106853, Expressed in jejunal mucosa and 213 other tissues
    ExpressionAtlasiQ14914, baseline and differential
    GenevisibleiQ14914, HS

    Family and domain databases

    CDDicd08294, leukotriene_B4_DH_like, 1 hit
    InterProiView protein in InterPro
    IPR013149, ADH_C
    IPR041694, ADH_N_2
    IPR011032, GroES-like_sf
    IPR036291, NAD(P)-bd_dom_sf
    IPR020843, PKS_ER
    IPR014190, PTGR1
    PfamiView protein in Pfam
    PF16884, ADH_N_2, 1 hit
    PF00107, ADH_zinc_N, 1 hit
    SMARTiView protein in SMART
    SM00829, PKS_ER, 1 hit
    SUPFAMiSSF50129, SSF50129, 2 hits
    SSF51735, SSF51735, 1 hit
    TIGRFAMsiTIGR02825, B4_12hDH, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTGR1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14914
    Secondary accession number(s): A8K0N2
    , B4DPK3, F5GY50, Q8IYQ0, Q9H1X6
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: September 19, 2002
    Last modified: June 2, 2021
    This is version 195 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with genetic variants
      List of human entries with genetic variants
    3. Human variants curated from literature reports
      Index of human variants curated from literature reports
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again