Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q14802 (FXYD3_HUMAN)

Entry version 171 (11 Dec 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

FXYD domain-containing ion transport regulator 3

Gene

FXYD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na+ out of the cell and K+ into the cell (PubMed:17077088). Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1 (PubMed:21454534). Induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes (PubMed:7836447).3 Publications
Decreases the apparent K+ and Na+ affinity of the sodium/potassium-transporting ATPase over a large range of membrane potentials.1 Publication
Decreases the apparent K+ affinity of the sodium/potassium-transporting ATPase only at slightly negative and positive membrane potentials and increases the apparent Na+ affinity over a large range of membrane potentials.1 Publication

Miscellaneous

Marker of a cell type preferentially transformed by neu or ras oncoprotein.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
LigandPotassium, Sodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Protein family/group databases

Transport Classification Database

More...TCDBi		1.A.27.1.5 the phospholemman (plm) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FXYD domain-containing ion transport regulator 3
Alternative name(s):
Chloride conductance inducer protein Mat-8
Mammary tumor 8 kDa protein
Phospholemman-like
Sodium/potassium-transporting ATPase subunit FXYD3Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FXYD3
Synonyms:MAT8, PLML
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000089356.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:4027 FXYD3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604996 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q14802

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 38ExtracellularSequence analysisAdd BLAST18
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei39 – 59HelicalSequence analysisAdd BLAST21
Topological domaini60 – 87CytoplasmicSequence analysisAdd BLAST28

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi44C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-49; S-61 and S-63. 1 Publication1
Mutagenesisi49C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-61 and S-63. 1 Publication1
Mutagenesisi61C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-49 and S-63. 1 Publication1
Mutagenesisi63C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-49 and S-61. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5349

Open Targets

More...OpenTargetsi		ENSG00000089356

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28443

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q14802 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FXYD3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 201 PublicationAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001036221 – 87FXYD domain-containing ion transport regulator 3Add BLAST67

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glutathionylated.1 Publication

Keywords - PTMi

Glutathionylation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q14802

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q14802

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q14802

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q14802

PeptideAtlas

More...PeptideAtlasi		Q14802

PRoteomics IDEntifications database

More...PRIDEi		Q14802

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25564
30673
60187 [Q14802-1]
60188 [Q14802-2]
9768

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q14802

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q14802

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1: Expressed mainly in differentiated cells (at protein level). Isoform 2: Expressed mainly in undifferentiated cells (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000089356 Expressed in 179 organ(s), highest expression level in mucosa of transverse colon

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q14802 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q14802 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA010856

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Regulatory subunit of the sodium/potassium-transporting ATPase which is composed of a catalytic alpha subunit, a non-catalytic beta subunit and an additional regulatory subunit (PubMed:17077088).

Interacts with catalytic alpha subunit ATP1A1 (PubMed:21454534).

Also interacts with non-catalytic beta subunit ATP1B1 (By similarity).

Interacts with the ATP1A1-ATP1B1, ATP1A2-ATP1B1 and ATP1A3-ATP1B1 NKA isozymes (PubMed:17077088).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111364, 8 interactors

Protein interaction database and analysis system

More...IntActi		Q14802, 54 interactors

Molecular INTeraction database

More...MINTi		Q14802

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000473929

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q14802 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q14802

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FXYD family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410J4PQ Eukaryota
ENOG4111AWX LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153062

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000234469

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q14802

KEGG Orthology (KO)

More...KOi		K13361

Identification of Orthologs from Complete Genome Data

More...OMAi		IVLMSEW

Database of Orthologous Groups

More...OrthoDBi		1606794at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q14802

TreeFam database of animal gene trees

More...TreeFami		TF333443

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000272 Ion-transport_regulator_FXYD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02038 ATP1G1_PLM_MAT8, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01310 FXYD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14802-1) [UniParc]FASTAAdd to basket
Also known as: FXYD3-sf1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQKVTLGLLV FLAGFPVLDA NDLEDKNSPF YYDWHSLQVG GLICAGVLCA 
        60         70         80 
MGIIIVMSAK CKCKFGQKSG HHPGETPPLI TPGSAQS
Length:87
Mass (Da):9,263
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6D674D668EB32493
GO
Isoform 2 (identifier: Q14802-2) [UniParc]FASTAAdd to basket
Also known as: FXYD3-lf1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: S → SEWRSSGEQAGRGWGSPPLTTQLSPTG

Show »
Length:113
Mass (Da):11,988
Checksum:i76E2065D324DD3FB
GO
Isoform 3 (identifier: Q14802-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRGYSGALQARGGLEEPLERGLRGPSFTQSPLHGAAAAYLSAQRDASLPVPGQRSDM

Show »
Length:144
Mass (Da):15,154
Checksum:i7046A16E5C9011DE
GO
Isoform 4 (identifier: Q14802-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: S → SEWRSSGEQAGRGWGSPPLTTQLSPTG
     71-87: Missing.

Show »
Length:96
Mass (Da):10,280
Checksum:iC6D6FB0FB15FC085
GO
Isoform 5 (identifier: Q14802-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-87: DWHSLQVGGL...PLITPGSAQS → GESPCPLSPPHNPTYCLVPRVPIQGWGLT

Show »
Length:61
Mass (Da):6,718
Checksum:i22954B2FECB88A28
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R445S4R445_HUMAN
FXYD domain-containing ion transpor...
FXYD3
116Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3M2S4R3M2_HUMAN
FXYD domain-containing ion transpor...
FXYD3
70Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti36 – 37Missing in AAA73922 (Ref. 2) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04910940G → S. Corresponds to variant dbSNP:rs35578165Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0457161M → MGRGYSGALQARGGLEEPLE RGLRGPSFTQSPLHGAAAAY LSAQRDASLPVPGQRSDM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04728633 – 87DWHSL…GSAQS → GESPCPLSPPHNPTYCLVPR VPIQGWGLT in isoform 5. CuratedAdd BLAST55
Alternative sequenceiVSP_03459858S → SEWRSSGEQAGRGWGSPPLT TQLSPTG in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04728771 – 87Missing in isoform 4. CuratedAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X93036 mRNA Translation: CAA63604.1
U28249 mRNA Translation: AAA73922.1
BT006712 mRNA Translation: AAP35358.1
CR456945 mRNA Translation: CAG33226.1
CR542197 mRNA Translation: CAG46994.1
AC020907 Genomic DNA No translation available.
BC005238 mRNA Translation: AAH05238.1
BC090044 mRNA Translation: AAH90044.1
BU157560 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12442.1 [Q14802-1]
CCDS12443.1 [Q14802-2]
CCDS46048.1 [Q14802-3]
CCDS46049.1 [Q14802-4]
CCDS46050.1 [Q14802-5]

Protein sequence database of the Protein Information Resource

More...PIRi		A55571

NCBI Reference Sequences

More...RefSeqi		NP_001129479.1, NM_001136007.1 [Q14802-3]
NP_001129480.1, NM_001136008.1 [Q14802-4]
NP_001129481.1, NM_001136009.1 [Q14802-5]
NP_001129482.1, NM_001136010.1 [Q14802-5]
NP_001129483.1, NM_001136011.1 [Q14802-1]
NP_001129484.1, NM_001136012.1 [Q14802-2]
NP_005962.1, NM_005971.3 [Q14802-1]
NP_068710.1, NM_021910.2 [Q14802-2]
XP_005259053.1, XM_005258996.4 [Q14802-2]
XP_016882366.1, XM_017026877.1 [Q14802-1]
XP_016882367.1, XM_017026878.1 [Q14802-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000344013; ENSP00000339499; ENSG00000089356 [Q14802-2]
ENST00000346446; ENSP00000328259; ENSG00000089356 [Q14802-2]
ENST00000435734; ENSP00000389770; ENSG00000089356 [Q14802-2]
ENST00000603181; ENSP00000474851; ENSG00000089356 [Q14802-1]
ENST00000603449; ENSP00000474055; ENSG00000089356 [Q14802-5]
ENST00000604255; ENSP00000473929; ENSG00000089356 [Q14802-3]
ENST00000604404; ENSP00000474438; ENSG00000089356 [Q14802-1]
ENST00000604621; ENSP00000474526; ENSG00000089356 [Q14802-1]
ENST00000605552; ENSP00000474855; ENSG00000089356 [Q14802-5]
ENST00000605677; ENSP00000474622; ENSG00000089356 [Q14802-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5349

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5349

UCSC genome browser

More...UCSCi		uc002nxv.4 human [Q14802-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93036 mRNA Translation: CAA63604.1
U28249 mRNA Translation: AAA73922.1
BT006712 mRNA Translation: AAP35358.1
CR456945 mRNA Translation: CAG33226.1
CR542197 mRNA Translation: CAG46994.1
AC020907 Genomic DNA No translation available.
BC005238 mRNA Translation: AAH05238.1
BC090044 mRNA Translation: AAH90044.1
BU157560 mRNA No translation available.
CCDSiCCDS12442.1 [Q14802-1]
CCDS12443.1 [Q14802-2]
CCDS46048.1 [Q14802-3]
CCDS46049.1 [Q14802-4]
CCDS46050.1 [Q14802-5]
PIRiA55571
RefSeqiNP_001129479.1, NM_001136007.1 [Q14802-3]
NP_001129480.1, NM_001136008.1 [Q14802-4]
NP_001129481.1, NM_001136009.1 [Q14802-5]
NP_001129482.1, NM_001136010.1 [Q14802-5]
NP_001129483.1, NM_001136011.1 [Q14802-1]
NP_001129484.1, NM_001136012.1 [Q14802-2]
NP_005962.1, NM_005971.3 [Q14802-1]
NP_068710.1, NM_021910.2 [Q14802-2]
XP_005259053.1, XM_005258996.4 [Q14802-2]
XP_016882366.1, XM_017026877.1 [Q14802-1]
XP_016882367.1, XM_017026878.1 [Q14802-1]

3D structure databases

SMRiQ14802
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111364, 8 interactors
IntActiQ14802, 54 interactors
MINTiQ14802
STRINGi9606.ENSP00000473929

Protein family/group databases

TCDBi1.A.27.1.5 the phospholemman (plm) family

PTM databases

iPTMnetiQ14802
PhosphoSitePlusiQ14802

Polymorphism and mutation databases

BioMutaiFXYD3

Proteomic databases

jPOSTiQ14802
MassIVEiQ14802
MaxQBiQ14802
PaxDbiQ14802
PeptideAtlasiQ14802
PRIDEiQ14802
ProteomicsDBi25564
30673
60187 [Q14802-1]
60188 [Q14802-2]
9768

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5349

Genome annotation databases

EnsembliENST00000344013; ENSP00000339499; ENSG00000089356 [Q14802-2]
ENST00000346446; ENSP00000328259; ENSG00000089356 [Q14802-2]
ENST00000435734; ENSP00000389770; ENSG00000089356 [Q14802-2]
ENST00000603181; ENSP00000474851; ENSG00000089356 [Q14802-1]
ENST00000603449; ENSP00000474055; ENSG00000089356 [Q14802-5]
ENST00000604255; ENSP00000473929; ENSG00000089356 [Q14802-3]
ENST00000604404; ENSP00000474438; ENSG00000089356 [Q14802-1]
ENST00000604621; ENSP00000474526; ENSG00000089356 [Q14802-1]
ENST00000605552; ENSP00000474855; ENSG00000089356 [Q14802-5]
ENST00000605677; ENSP00000474622; ENSG00000089356 [Q14802-4]
GeneIDi5349
KEGGihsa:5349
UCSCiuc002nxv.4 human [Q14802-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5349
DisGeNETi5349
EuPathDBiHostDB:ENSG00000089356.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		FXYD3
HGNCiHGNC:4027 FXYD3
HPAiHPA010856
MIMi604996 gene
neXtProtiNX_Q14802
OpenTargetsiENSG00000089356
PharmGKBiPA28443

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410J4PQ Eukaryota
ENOG4111AWX LUCA
GeneTreeiENSGT00940000153062
HOGENOMiHOG000234469
InParanoidiQ14802
KOiK13361
OMAiIVLMSEW
OrthoDBi1606794at2759
PhylomeDBiQ14802
TreeFamiTF333443

Enzyme and pathway databases

ReactomeiR-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FXYD3 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FXYD3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5349
PharosiQ14802 Tbio

Protein Ontology

More...PROi		PR:Q14802
RNActiQ14802 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000089356 Expressed in 179 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasiQ14802 baseline and differential
GenevisibleiQ14802 HS

Family and domain databases

InterProiView protein in InterPro
IPR000272 Ion-transport_regulator_FXYD
PfamiView protein in Pfam
PF02038 ATP1G1_PLM_MAT8, 1 hit
PROSITEiView protein in PROSITE
PS01310 FXYD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFXYD3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14802
Secondary accession number(s): A6NDE0
, C9JDU2, F5H174, F8WB34, Q13211, Q6IB59
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: December 11, 2019
This is version 171 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again