Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FXYD domain-containing ion transport regulator 3

Gene

FXYD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which transports Na+ out of the cell and K+ into the cell (PubMed:17077088). Reduces glutathionylation of the NKA beta-1 subunit ATP1B1, thus reversing glutathionylation-mediated inhibition of ATP1B1 (PubMed:21454534). Induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes (PubMed:7836447).3 Publications
Isoform 1: Decreases the apparent K+ and Na+ affinity of the sodium/potassium-transporting ATPase over a large range of membrane potentials.1 Publication
Isoform 2: Decreases the apparent K+ affinity of the sodium/potassium-transporting ATPase only at slightly negative and positive membrane potentials and increases the apparent Na+ affinity over a large range of membrane potentials.1 Publication

Miscellaneous

Marker of a cell type preferentially transformed by neu or ras oncoprotein.

GO - Molecular functioni

  • chloride channel activity Source: ProtInc
  • sodium channel regulator activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processIon transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
LigandPotassium, Sodium

Enzyme and pathway databases

ReactomeiR-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Protein family/group databases

TCDBi1.A.27.1.5 the phospholemman (plm) family

Names & Taxonomyi

Protein namesi
Recommended name:
FXYD domain-containing ion transport regulator 3
Alternative name(s):
Chloride conductance inducer protein Mat-8
Mammary tumor 8 kDa protein
Phospholemman-like
Sodium/potassium-transporting ATPase subunit FXYD3Curated
Gene namesi
Name:FXYD3
Synonyms:MAT8, PLML
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000089356.16
HGNCiHGNC:4027 FXYD3
MIMi604996 gene
neXtProtiNX_Q14802

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 38ExtracellularSequence analysisAdd BLAST18
Transmembranei39 – 59HelicalSequence analysisAdd BLAST21
Topological domaini60 – 87CytoplasmicSequence analysisAdd BLAST28

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi44C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-49; S-61 and S-63. 1 Publication1
Mutagenesisi49C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-61 and S-63. 1 Publication1
Mutagenesisi61C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-49 and S-63. 1 Publication1
Mutagenesisi63C → S: Abolishes glutathionylation but does not affect interaction with ATP1B1; when associated with S-43; S-49 and S-61. 1 Publication1

Organism-specific databases

DisGeNETi5349
OpenTargetsiENSG00000089356
PharmGKBiPA28443

Polymorphism and mutation databases

BioMutaiFXYD3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 201 PublicationAdd BLAST20
ChainiPRO_000001036221 – 87FXYD domain-containing ion transport regulator 3Add BLAST67

Post-translational modificationi

Glutathionylated.1 Publication

Keywords - PTMi

Glutathionylation

Proteomic databases

MaxQBiQ14802
PaxDbiQ14802
PeptideAtlasiQ14802
PRIDEiQ14802
ProteomicsDBi60187
60188 [Q14802-2]

PTM databases

iPTMnetiQ14802
PhosphoSitePlusiQ14802

Expressioni

Tissue specificityi

Isoform 1: Expressed mainly in differentiated cells (at protein level). Isoform 2: Expressed mainly in undifferentiated cells (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000089356 Expressed in 179 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_FXYD3
ExpressionAtlasiQ14802 baseline and differential
GenevisibleiQ14802 HS

Organism-specific databases

HPAiHPA010856

Interactioni

Subunit structurei

Regulatory subunit of the sodium/potassium-transporting ATPase which is composed of a catalytic alpha subunit, a non-catalytic beta subunit and an additional regulatory subunit (PubMed:17077088). Interacts with catalytic alpha subunit ATP1A1 (PubMed:21454534). Also interacts with non-catalytic beta subunit ATP1B1 (By similarity). Interacts with the ATP1A1-ATP1B1, ATP1A2-ATP1B1 and ATP1A3-ATP1B1 NKA isozymes (PubMed:17077088).By similarity2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi111364, 8 interactors
IntActiQ14802, 54 interactors
MINTiQ14802
STRINGi9606.ENSP00000389770

Structurei

3D structure databases

ProteinModelPortaliQ14802
SMRiQ14802
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FXYD family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J4PQ Eukaryota
ENOG4111AWX LUCA
GeneTreeiENSGT00530000063998
HOGENOMiHOG000234469
HOVERGENiHBG008212
InParanoidiQ14802
KOiK13361
OMAiIVLMSEW
OrthoDBiEOG091G14HJ
PhylomeDBiQ14802
TreeFamiTF333443

Family and domain databases

InterProiView protein in InterPro
IPR000272 Ion-transport_regulator_FXYD
PfamiView protein in Pfam
PF02038 ATP1G1_PLM_MAT8, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD005989 PD005989, 1 hit
PROSITEiView protein in PROSITE
PS01310 FXYD, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14802-1) [UniParc]FASTAAdd to basket
Also known as: FXYD3-sf1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQKVTLGLLV FLAGFPVLDA NDLEDKNSPF YYDWHSLQVG GLICAGVLCA
60 70 80
MGIIIVMSAK CKCKFGQKSG HHPGETPPLI TPGSAQS
Length:87
Mass (Da):9,263
Last modified:November 1, 1996 - v1
Checksum:i6D674D668EB32493
GO
Isoform 2 (identifier: Q14802-2) [UniParc]FASTAAdd to basket
Also known as: FXYD3-lf1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: S → SEWRSSGEQAGRGWGSPPLTTQLSPTG

Show »
Length:113
Mass (Da):11,988
Checksum:i76E2065D324DD3FB
GO
Isoform 3 (identifier: Q14802-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRGYSGALQARGGLEEPLERGLRGPSFTQSPLHGAAAAYLSAQRDASLPVPGQRSDM

Note: No experimental confirmation available.
Show »
Length:144
Mass (Da):15,154
Checksum:i7046A16E5C9011DE
GO
Isoform 4 (identifier: Q14802-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: S → SEWRSSGEQAGRGWGSPPLTTQLSPTG
     71-87: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:96
Mass (Da):10,280
Checksum:iC6D6FB0FB15FC085
GO
Isoform 5 (identifier: Q14802-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-87: DWHSLQVGGL...PLITPGSAQS → GESPCPLSPPHNPTYCLVPRVPIQGWGLT

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:61
Mass (Da):6,718
Checksum:i22954B2FECB88A28
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3M2S4R3M2_HUMAN
FXYD domain-containing ion transpor...
FXYD3
70Annotation score:
S4R445S4R445_HUMAN
FXYD domain-containing ion transpor...
FXYD3
116Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti36 – 37Missing in AAA73922 (Ref. 2) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04910940G → S. Corresponds to variant dbSNP:rs35578165Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0457161M → MGRGYSGALQARGGLEEPLE RGLRGPSFTQSPLHGAAAAY LSAQRDASLPVPGQRSDM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04728633 – 87DWHSL…GSAQS → GESPCPLSPPHNPTYCLVPR VPIQGWGLT in isoform 5. CuratedAdd BLAST55
Alternative sequenceiVSP_03459858S → SEWRSSGEQAGRGWGSPPLT TQLSPTG in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04728771 – 87Missing in isoform 4. CuratedAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93036 mRNA Translation: CAA63604.1
U28249 mRNA Translation: AAA73922.1
BT006712 mRNA Translation: AAP35358.1
CR456945 mRNA Translation: CAG33226.1
CR542197 mRNA Translation: CAG46994.1
AC020907 Genomic DNA No translation available.
BC005238 mRNA Translation: AAH05238.1
BC090044 mRNA Translation: AAH90044.1
BU157560 mRNA No translation available.
CCDSiCCDS12442.1 [Q14802-1]
CCDS12443.1 [Q14802-2]
CCDS46048.1 [Q14802-3]
CCDS46049.1 [Q14802-4]
CCDS46050.1 [Q14802-5]
PIRiA55571
RefSeqiNP_001129479.1, NM_001136007.1 [Q14802-3]
NP_001129480.1, NM_001136008.1 [Q14802-4]
NP_001129481.1, NM_001136009.1 [Q14802-5]
NP_001129482.1, NM_001136010.1 [Q14802-5]
NP_001129483.1, NM_001136011.1 [Q14802-1]
NP_001129484.1, NM_001136012.1 [Q14802-2]
NP_005962.1, NM_005971.3 [Q14802-1]
NP_068710.1, NM_021910.2 [Q14802-2]
XP_005259053.1, XM_005258996.4 [Q14802-2]
XP_016882366.1, XM_017026877.1 [Q14802-1]
XP_016882367.1, XM_017026878.1 [Q14802-1]
UniGeneiHs.301350

Genome annotation databases

EnsembliENST00000344013; ENSP00000339499; ENSG00000089356 [Q14802-2]
ENST00000346446; ENSP00000328259; ENSG00000089356 [Q14802-2]
ENST00000435734; ENSP00000389770; ENSG00000089356 [Q14802-2]
ENST00000603181; ENSP00000474851; ENSG00000089356 [Q14802-1]
ENST00000603449; ENSP00000474055; ENSG00000089356 [Q14802-5]
ENST00000604255; ENSP00000473929; ENSG00000089356 [Q14802-3]
ENST00000604404; ENSP00000474438; ENSG00000089356 [Q14802-1]
ENST00000604621; ENSP00000474526; ENSG00000089356 [Q14802-1]
ENST00000605552; ENSP00000474855; ENSG00000089356 [Q14802-5]
ENST00000605677; ENSP00000474622; ENSG00000089356 [Q14802-4]
GeneIDi5349
KEGGihsa:5349
UCSCiuc002nxv.4 human [Q14802-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93036 mRNA Translation: CAA63604.1
U28249 mRNA Translation: AAA73922.1
BT006712 mRNA Translation: AAP35358.1
CR456945 mRNA Translation: CAG33226.1
CR542197 mRNA Translation: CAG46994.1
AC020907 Genomic DNA No translation available.
BC005238 mRNA Translation: AAH05238.1
BC090044 mRNA Translation: AAH90044.1
BU157560 mRNA No translation available.
CCDSiCCDS12442.1 [Q14802-1]
CCDS12443.1 [Q14802-2]
CCDS46048.1 [Q14802-3]
CCDS46049.1 [Q14802-4]
CCDS46050.1 [Q14802-5]
PIRiA55571
RefSeqiNP_001129479.1, NM_001136007.1 [Q14802-3]
NP_001129480.1, NM_001136008.1 [Q14802-4]
NP_001129481.1, NM_001136009.1 [Q14802-5]
NP_001129482.1, NM_001136010.1 [Q14802-5]
NP_001129483.1, NM_001136011.1 [Q14802-1]
NP_001129484.1, NM_001136012.1 [Q14802-2]
NP_005962.1, NM_005971.3 [Q14802-1]
NP_068710.1, NM_021910.2 [Q14802-2]
XP_005259053.1, XM_005258996.4 [Q14802-2]
XP_016882366.1, XM_017026877.1 [Q14802-1]
XP_016882367.1, XM_017026878.1 [Q14802-1]
UniGeneiHs.301350

3D structure databases

ProteinModelPortaliQ14802
SMRiQ14802
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111364, 8 interactors
IntActiQ14802, 54 interactors
MINTiQ14802
STRINGi9606.ENSP00000389770

Protein family/group databases

TCDBi1.A.27.1.5 the phospholemman (plm) family

PTM databases

iPTMnetiQ14802
PhosphoSitePlusiQ14802

Polymorphism and mutation databases

BioMutaiFXYD3

Proteomic databases

MaxQBiQ14802
PaxDbiQ14802
PeptideAtlasiQ14802
PRIDEiQ14802
ProteomicsDBi60187
60188 [Q14802-2]

Protocols and materials databases

DNASUi5349
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344013; ENSP00000339499; ENSG00000089356 [Q14802-2]
ENST00000346446; ENSP00000328259; ENSG00000089356 [Q14802-2]
ENST00000435734; ENSP00000389770; ENSG00000089356 [Q14802-2]
ENST00000603181; ENSP00000474851; ENSG00000089356 [Q14802-1]
ENST00000603449; ENSP00000474055; ENSG00000089356 [Q14802-5]
ENST00000604255; ENSP00000473929; ENSG00000089356 [Q14802-3]
ENST00000604404; ENSP00000474438; ENSG00000089356 [Q14802-1]
ENST00000604621; ENSP00000474526; ENSG00000089356 [Q14802-1]
ENST00000605552; ENSP00000474855; ENSG00000089356 [Q14802-5]
ENST00000605677; ENSP00000474622; ENSG00000089356 [Q14802-4]
GeneIDi5349
KEGGihsa:5349
UCSCiuc002nxv.4 human [Q14802-1]

Organism-specific databases

CTDi5349
DisGeNETi5349
EuPathDBiHostDB:ENSG00000089356.16
GeneCardsiFXYD3
HGNCiHGNC:4027 FXYD3
HPAiHPA010856
MIMi604996 gene
neXtProtiNX_Q14802
OpenTargetsiENSG00000089356
PharmGKBiPA28443
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J4PQ Eukaryota
ENOG4111AWX LUCA
GeneTreeiENSGT00530000063998
HOGENOMiHOG000234469
HOVERGENiHBG008212
InParanoidiQ14802
KOiK13361
OMAiIVLMSEW
OrthoDBiEOG091G14HJ
PhylomeDBiQ14802
TreeFamiTF333443

Enzyme and pathway databases

ReactomeiR-HSA-5578775 Ion homeostasis
R-HSA-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRSiFXYD3 human
GeneWikiiFXYD3
GenomeRNAii5349
PROiPR:Q14802
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000089356 Expressed in 179 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_FXYD3
ExpressionAtlasiQ14802 baseline and differential
GenevisibleiQ14802 HS

Family and domain databases

InterProiView protein in InterPro
IPR000272 Ion-transport_regulator_FXYD
PfamiView protein in Pfam
PF02038 ATP1G1_PLM_MAT8, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD005989 PD005989, 1 hit
PROSITEiView protein in PROSITE
PS01310 FXYD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFXYD3_HUMAN
AccessioniPrimary (citable) accession number: Q14802
Secondary accession number(s): A6NDE0
, C9JDU2, F5H174, F8WB34, Q13211, Q6IB59
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: November 7, 2018
This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again