Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q14790 (CASP8_HUMAN)

Entry version 245 (02 Jun 2021)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Caspase-8

Gene

CASP8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood (By similarity).

Initiator protease that induces extrinsic apoptosis by mediating cleavage and activation of effector caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death (PubMed:23516580, PubMed:8681376, PubMed:8681377, PubMed:9006941, PubMed:9184224, PubMed:8962078).

Cleaves and activates effector caspases CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10 (PubMed:8962078, PubMed:9006941).

Binding to the adapter molecule FADD recruits it to either receptor TNFRSF6/FAS mediated or TNFRSF1A (PubMed:8681376, PubMed:8681377).

The resulting aggregate called death-inducing signaling complex (DISC) performs CASP8 proteolytic activation (PubMed:9184224).

The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases (PubMed:9184224).

Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC (PubMed:9184224).

In addition to extrinsic apoptosis, also acts as a negative regulator of necroptosis: acts by cleaving RIPK1 at 'Asp-324', which is crucial to inhibit RIPK1 kinase activity, limiting TNF-induced apoptosis, necroptosis and inflammatory response (PubMed:31827280, PubMed:31827281).

Also able to initiate pyroptosis by mediating cleavage and activation of gasdermin-D (GSDMD): GSDMD cleavage promoting release of the N-terminal moiety (Gasdermin-D, N-terminal) that binds to membranes and forms pores, triggering pyroptosis (By similarity).

Initiates pyroptosis following inactivation of MAP3K7/TAK1 (By similarity).

Also acts as a regulator of innate immunity by mediating cleavage and inactivation of N4BP1 downstream of TLR3 or TLR4, thereby promoting cytokine production (By similarity).

May participate in the Granzyme B (GZMB) cell death pathways (PubMed:8755496).

Cleaves PARP1 (PubMed:8681376).

By similarity9 Publications

Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.

1 Publication

Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.

1 Publication

Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex (Probable). Acts as an inhibitor of the caspase cascade (PubMed:12010809).

1 Publication1 Publication

Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

CASP8 activity is restricted by RIPK1 (By similarity). Inhibited by the effector protein NleF that is produced by pathogenic E.coli; this inhibits apoptosis (PubMed:23516580).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3171 Publication1
Active sitei3601 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.22.61, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q14790

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111465, Apoptotic cleavage of cellular proteins
R-HSA-140534, Caspase activation via Death Receptors in the presence of ligand
R-HSA-168638, NOD1/2 Signaling Pathway
R-HSA-2562578, TRIF-mediated programmed cell death
R-HSA-264870, Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-3371378, Regulation by c-FLIP
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5660668, CLEC7A/inflammasome pathway
R-HSA-5675482, Regulation of necroptotic cell death
R-HSA-69416, Dimerization of procaspase-8
R-HSA-75108, Activation, myristolyation of BID and translocation to mitochondria
R-HSA-75153, Apoptotic execution phase
R-HSA-75157, FasL/ CD95L signaling
R-HSA-75158, TRAIL signaling
R-HSA-9013957, TLR3-mediated TICAM1-dependent programmed cell death
R-HSA-933543, NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
R-HSA-9686347, Microbial modulation of RIPK1-mediated regulated necrosis
R-HSA-9693928, Defective RIPK1-mediated regulated necrosis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q14790

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q14790

Protein family/group databases

MEROPS protease database

More...MEROPSi		C14.009

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Caspase-81 Publication (EC:3.4.22.612 Publications)
Short name:
CASP-81 Publication
Alternative name(s):
Apoptotic cysteine protease
Apoptotic protease Mch-51 Publication
CAP4
FADD-homologous ICE/ced-3-like protease1 Publication
FADD-like ICE1 Publication
Short name:
FLICE1 Publication
ICE-like apoptotic protease 5
MORT1-associated ced-3 homolog1 Publication
Short name:
MACH1 Publication
Cleaved into the following 2 chains:
Caspase-8 subunit p181 Publication
Caspase-8 subunit p101 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CASP81 PublicationImported
Synonyms:MCH51 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1509, CASP8

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601763, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q14790

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000064012.21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Caspase-8 deficiency (CASP8D)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionDisorder resembling autoimmune lymphoproliferative syndrome (ALPS). It is characterized by lymphadenopathy, splenomegaly, and defective CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It leads to defects in activation of T-lymphocytes, B-lymphocytes, and natural killer cells leading to immunodeficiency characterized by recurrent sinopulmonary and herpes simplex virus infections and poor responses to immunization.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_014204248R → W in CASP8D. 1 PublicationCorresponds to variant dbSNP:rs17860424EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi73D → A: Abolishes binding to FLASH. Induces NF-kappa-B activation. 1 Publication1
Mutagenesisi360C → S: Abolishes interaction with UBR2. 1 Publication1
Mutagenesisi387S → A: Impaired CDK1-mediated phosphorylation and enhanced apoptosis. 1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		841

MalaCards human disease database

More...MalaCardsi		CASP8
MIMi211980, phenotype
607271, phenotype

Open Targets

More...OpenTargetsi		ENSG00000064012

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		210159, Adult hepatocellular carcinoma
275517, Autoimmune lymphoproliferative syndrome with recurrent viral infections

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26092

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q14790, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3776

Drug and drug target database

More...DrugBanki		DB12651, Bardoxolone
DB11752, Bryostatin 1

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1624

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CASP8

Domain mapping of disease mutations (DMDM)

More...DMDMi		2493531

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000046281 – 2162 PublicationsAdd BLAST216
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000004629217 – 374Caspase-8 subunit p18Add BLAST158
PropeptideiPRO_0000004630375 – 3842 Publications10
ChainiPRO_0000004631385 – 479Caspase-8 subunit p10Add BLAST95

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei188PhosphoserineBy similarity1
Modified residuei211PhosphoserineBy similarity1
Modified residuei224N6-acetyllysineBy similarity1
Modified residuei334PhosphotyrosineCombined sources1
Modified residuei387Phosphoserine; by CDK11 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

(Microbial infection) Proteolytically cleaved by the cowpox virus CRMA death inhibitory protein.1 Publication
Generation of the subunits requires association with the death-inducing signaling complex (DISC), whereas additional processing is likely due to the autocatalytic activity of the activated protease. GZMB and CASP10 can be involved in these processing events.2 Publications
Phosphorylation on Ser-387 during mitosis by CDK1 inhibits activation by proteolysis and prevents apoptosis. This phosphorylation occurs in cancer cell lines, as well as in primary breast tissues and lymphocytes.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei216 – 217Cleavage; by autocatalytic cleavage2 Publications2
Sitei384 – 385Cleavage; by autocatalytic cleavage2 Publications2

Keywords - PTMi

Acetylation, Phosphoprotein, Zymogen

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-794
CPTAC-795

Encyclopedia of Proteome Dynamics

More...EPDi		Q14790

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q14790

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q14790

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q14790

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q14790

PeptideAtlas

More...PeptideAtlasi		Q14790

PRoteomics IDEntifications database

More...PRIDEi		Q14790

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60172 [Q14790-1]
60173 [Q14790-2]
60174 [Q14790-3]
60175 [Q14790-4]
60176 [Q14790-5]
60177 [Q14790-6]
60178 [Q14790-7]
60179 [Q14790-8]
60180 [Q14790-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q14790

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q14790

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q14790

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000064012, Expressed in small intestine Peyer's patch and 211 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q14790, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q14790, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000064012, Tissue enhanced (blood)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit (PubMed:10508784).

Interacts with FADD, CFLAR and PEA15 (PubMed:10442631).

Interacts with TNFAIP8L2 (By similarity).

Interacts with CASP8AP2 (PubMed:16378960).

Interacts with RFFL and RNF34; negatively regulate CASP8 through proteasomal degradation (PubMed:15069192).

Interacts with NOL3; decreases CASP8 activity in a mitochondria localization- and phosphorylation-dependent manner and this interaction is dissociated by calcium (PubMed:15509781).

Interacts with UBR2ca (PubMed:28602583).

Interacts with RIPK1 (By similarity).

Interacts with stimulated TNFRSF10B; this interaction is followed by CASP8 proteolytic cleavage and activation (PubMed:18846110).

By similarity7 Publications

Interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1.

2 Publications

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vICA/UL36; this interaction inhibits CASP8 activation.

1 Publication

(Microbial infection) Interacts with NleF from pathogenic E.coli.

1 Publication

(Microbial infection) Interacts with molluscum contagiosum virus protein MC160.

1 Publication

(Microbial infection) Interacts (via RIP homotypic interaction motif) with herpes simplex virus 1/HHV-1 protein RIR1/ICP6 (via RIP homotypic interaction motif); this interaction prevents necroptosis activation.

1 Publication

(Microbial infection) Interacts (via RIP homotypic interaction motif) with herpes simplex virus 2/HHV-2 protein RIR1/ICP10 (via RIP homotypic interaction motif); this interaction prevents necroptosis activation.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107291, 168 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1907, Ripoptosome
CPX-975, Caspase-8 complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q14790

Database of interacting proteins

More...DIPi		DIP-30915N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q14790

Protein interaction database and analysis system

More...IntActi		Q14790, 130 interactors

Molecular INTeraction database

More...MINTi		Q14790

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000351273

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q14790

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q14790, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1479
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q14790

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q14790

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q14790

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 80DED 1PROSITE-ProRule annotationAdd BLAST79
Domaini100 – 177DED 2PROSITE-ProRule annotationAdd BLAST78

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains a N-terminal extension that is required for interaction with the BCAP31 complex.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3573, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160319

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_036904_4_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q14790

Identification of Orthologs from Complete Genome Data

More...OMAi		SDKVYRM

Database of Orthologous Groups

More...OrthoDBi		939331at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q14790

TreeFam database of animal gene trees

More...TreeFami		TF102023

Family and domain databases

Conserved Domains Database

More...CDDi		cd00032, CASc, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033170, Caspase-8
IPR029030, Caspase-like_dom_sf
IPR033139, Caspase_cys_AS
IPR016129, Caspase_his_AS
IPR011029, DEATH-like_dom_sf
IPR001875, DED_dom
IPR002398, Pept_C14
IPR002138, Pept_C14_p10
IPR001309, Pept_C14_p20
IPR015917, Pept_C14A

The PANTHER Classification System

More...PANTHERi		PTHR10454, PTHR10454, 1 hit
PTHR10454:SF162, PTHR10454:SF162, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01335, DED, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00376, IL1BCENZYME

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00115, CASc, 1 hit
SM00031, DED, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47986, SSF47986, 2 hits
SSF52129, SSF52129, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01122, CASPASE_CYS, 1 hit
PS01121, CASPASE_HIS, 1 hit
PS50207, CASPASE_P10, 1 hit
PS50208, CASPASE_P20, 1 hit
PS50168, DED, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14790-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFSRNLYDI GEQLDSEDLA SLKFLSLDYI PQRKQEPIKD ALMLFQRLQE 
        60         70         80         90        100
KRMLEESNLS FLKELLFRIN RLDLLITYLN TRKEEMEREL QTPGRAQISA 
       110        120        130        140        150
YRVMLYQISE EVSRSELRSF KFLLQEEISK CKLDDDMNLL DIFIEMEKRV 
       160        170        180        190        200
ILGEGKLDIL KRVCAQINKS LLKIINDYEE FSKERSSSLE GSPDEFSNGE 
       210        220        230        240        250
ELCGVMTISD SPREQDSESQ TLDKVYQMKS KPRGYCLIIN NHNFAKAREK 
       260        270        280        290        300
VPKLHSIRDR NGTHLDAGAL TTTFEELHFE IKPHDDCTVE QIYEILKIYQ 
       310        320        330        340        350
LMDHSNMDCF ICCILSHGDK GIIYGTDGQE APIYELTSQF TGLKCPSLAG 
       360        370        380        390        400
KPKVFFIQAC QGDNYQKGIP VETDSEEQPY LEMDLSSPQT RYIPDEADFL 
       410        420        430        440        450
LGMATVNNCV SYRNPAEGTW YIQSLCQSLR ERCPRGDDIL TILTEVNYEV 
       460        470 
SNKDDKKNMG KQMPQPTFTL RKKLVFPSD
Length:479
Mass (Da):55,391
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A5FEAA6B39B582F
GO
Isoform 2 (identifier: Q14790-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2, MCH5-beta

The sequence of this isoform differs from the canonical sequence as follows:
     184-198: Missing.

Show »
Length:464
Mass (Da):53,768
Checksum:i7F52F14ADE6A02B6
GO
Isoform 3 (identifier: Q14790-3) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     184-267: Missing.

Show »
Length:395
Mass (Da):45,929
Checksum:i2787AE831A2B36EF
GO
Isoform 4 (identifier: Q14790-4) [UniParc]FASTAAdd to basket
Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     102-102: R → RFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIR
     184-198: Missing.

Show »
Length:496
Mass (Da):57,701
Checksum:i68136650A49159D9
GO
Isoform 5 (identifier: Q14790-5) [UniParc]FASTAAdd to basket
Also known as: Beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     199-235: GEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGY → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH
     236-479: Missing.

Show »
Length:235
Mass (Da):27,484
Checksum:i7C9013CEA85A77DE
GO
Isoform 6 (identifier: Q14790-6) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     184-220: ERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQ → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH
     221-479: Missing.

Show »
Length:220
Mass (Da):25,862
Checksum:iF3DA0380D12006C7
GO
Isoform 7 (identifier: Q14790-7) [UniParc]FASTAAdd to basket
Also known as: Beta-3, 8L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     269-276: ALTTTFEE → TVEPKREK
     277-479: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:276
Mass (Da):32,330
Checksum:i227ED77718788F92
GO
Isoform 8 (identifier: Q14790-8) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     184-198: Missing.
     269-276: ALTTTFEE → TVEPKREK
     277-479: Missing.

Show »
Length:261
Mass (Da):30,707
Checksum:i19ACAE80171E0572
GO
Isoform 9 (identifier: Q14790-9) [UniParc]FASTAAdd to basket
Also known as: 8L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKM

Show »
Length:538
Mass (Da):61,836
Checksum:i54402ECFA9FE5E14
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C0E2H7C0E2_HUMAN
Caspase-8
CASP8
258Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ETB7E7ETB7_HUMAN
Caspase-8
CASP8
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQ06E7EQ06_HUMAN
Caspase-8
CASP8
209Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVN1E7EVN1_HUMAN
Caspase-8
CASP8
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQ01E7EQ01_HUMAN
Caspase-8
CASP8
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MS31A0A0A0MS31_HUMAN
Caspase-8
CASP8
278Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZM4H7BZM4_HUMAN
Caspase-8
CASP8
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JB29C9JB29_HUMAN
Caspase-8
CASP8
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WF39F8WF39_HUMAN
Caspase-8
CASP8
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA66858 differs from that shown.Curated
The sequence CAA66859 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti294E → D in AAD24962 (PubMed:9931493).Curated1
Sequence conflicti331A → P in AAC50602 (PubMed:8681377).Curated1
Sequence conflicti331A → P in AAD24962 (PubMed:9931493).Curated1
Sequence conflicti343 – 344LK → FG in AAL87631 (PubMed:11917123).Curated2
Isoform 9 (identifier: Q14790-9)
Sequence conflicti14K → R in AAL87628 (PubMed:11917123).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in CASP8 are associated with reduced risk of lung cancer [MIMi:211980] in a population of Han Chinese subjects. Genetic variations are also associated with decreased risk of cancer of various other forms including esophageal, gastric, colorectal, cervical, and breast, acting in an allele dose-dependent manner.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025816219S → T1 PublicationCorresponds to variant dbSNP:rs35976359EnsemblClinVar.1
Natural variantiVAR_014204248R → W in CASP8D. 1 PublicationCorresponds to variant dbSNP:rs17860424EnsemblClinVar.1
Natural variantiVAR_020127285D → H Associated with protection against breast cancer; also associated with a lower risk of cutaneous melanoma. 7 PublicationsCorresponds to variant dbSNP:rs1045485EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0008081M → MEGGRRARVVIESKRNFFLG AFPTPFPAEHVELGRLGDSE TAMVPGKGGADYILLPFKKM in isoform 9. 1 Publication1
Alternative sequenceiVSP_000809102R → RFHFCRMSWAEANSQCQTQS VPFWRRVDHLLIR in isoform 4. 1 Publication1
Alternative sequenceiVSP_000813184 – 267Missing in isoform 3. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_000811184 – 220ERSSS…DSESQ → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 6. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_000810184 – 198Missing in isoform 2, isoform 4 and isoform 8. 4 PublicationsAdd BLAST15
Alternative sequenceiVSP_000814199 – 235GEELC…KPRGY → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_000812221 – 479Missing in isoform 6. 1 PublicationAdd BLAST259
Alternative sequenceiVSP_000815236 – 479Missing in isoform 5. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_000816269 – 276ALTTTFEE → TVEPKREK in isoform 7 and isoform 8. 3 Publications8
Alternative sequenceiVSP_000817277 – 479Missing in isoform 7 and isoform 8. 3 PublicationsAdd BLAST203

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X98172 mRNA Translation: CAA66853.1
X98173 mRNA Translation: CAA66854.1
X98174 mRNA Translation: CAA66855.1
X98175 mRNA Translation: CAA66856.1
X98176 mRNA Translation: CAA66857.1
X98177 mRNA Translation: CAA66858.1 Sequence problems.
X98178 mRNA Translation: CAA66859.1 Sequence problems.
U58143 mRNA Translation: AAC50602.1
U60520 mRNA Translation: AAC50645.1
AF009620 mRNA Translation: AAB70913.1
AF102146 AF102145 Genomic DNA Translation: AAD24962.1
AB038985 Genomic DNA Translation: BAB32555.1
AF380342 mRNA Translation: AAK57437.1
AF422925 mRNA Translation: AAL87628.1
AF422926 mRNA Translation: AAL87629.1
AF422927 mRNA Translation: AAL87630.1
AF422928 mRNA Translation: AAL87631.1
AF422929 mRNA Translation: AAL87632.1
DQ355026 Genomic DNA Translation: ABC67468.1
AC007256 Genomic DNA Translation: AAY24225.1
BC028223 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2342.1 [Q14790-1]
CCDS2343.1 [Q14790-2]
CCDS2345.1 [Q14790-5]
CCDS42798.1 [Q14790-9]
CCDS42799.1 [Q14790-4]

NCBI Reference Sequences

More...RefSeqi		NP_001073593.1, NM_001080124.1 [Q14790-2]
NP_001073594.1, NM_001080125.1 [Q14790-9]
NP_001219.2, NM_001228.4 [Q14790-4]
NP_203519.1, NM_033355.3 [Q14790-1]
NP_203520.1, NM_033356.3 [Q14790-2]
NP_203522.1, NM_033358.3 [Q14790-5]
XP_005246943.1, XM_005246886.1
XP_005246944.1, XM_005246887.1 [Q14790-1]
XP_005246945.1, XM_005246888.1 [Q14790-1]
XP_005246946.1, XM_005246889.1 [Q14790-1]
XP_005246947.1, XM_005246890.3 [Q14790-1]
XP_005246948.1, XM_005246891.4 [Q14790-1]
XP_005246949.1, XM_005246892.1 [Q14790-2]
XP_006712852.1, XM_006712789.1 [Q14790-1]
XP_006712853.1, XM_006712790.3 [Q14790-1]
XP_006712856.1, XM_006712793.2 [Q14790-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264274; ENSP00000264274; ENSG00000064012 [Q14790-3]
ENST00000264275; ENSP00000264275; ENSG00000064012 [Q14790-4]
ENST00000323492; ENSP00000325722; ENSG00000064012 [Q14790-2]
ENST00000358485; ENSP00000351273; ENSG00000064012 [Q14790-9]
ENST00000392258; ENSP00000376087; ENSG00000064012 [Q14790-5]
ENST00000392263; ENSP00000376091; ENSG00000064012 [Q14790-2]
ENST00000432109; ENSP00000412523; ENSG00000064012 [Q14790-1]
ENST00000673742; ENSP00000501268; ENSG00000064012 [Q14790-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		841

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:841

UCSC genome browser

More...UCSCi		uc002uxo.2, human [Q14790-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

CASP8base

CASP8 mutation db

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X98172 mRNA Translation: CAA66853.1
X98173 mRNA Translation: CAA66854.1
X98174 mRNA Translation: CAA66855.1
X98175 mRNA Translation: CAA66856.1
X98176 mRNA Translation: CAA66857.1
X98177 mRNA Translation: CAA66858.1 Sequence problems.
X98178 mRNA Translation: CAA66859.1 Sequence problems.
U58143 mRNA Translation: AAC50602.1
U60520 mRNA Translation: AAC50645.1
AF009620 mRNA Translation: AAB70913.1
AF102146 AF102145 Genomic DNA Translation: AAD24962.1
AB038985 Genomic DNA Translation: BAB32555.1
AF380342 mRNA Translation: AAK57437.1
AF422925 mRNA Translation: AAL87628.1
AF422926 mRNA Translation: AAL87629.1
AF422927 mRNA Translation: AAL87630.1
AF422928 mRNA Translation: AAL87631.1
AF422929 mRNA Translation: AAL87632.1
DQ355026 Genomic DNA Translation: ABC67468.1
AC007256 Genomic DNA Translation: AAY24225.1
BC028223 mRNA No translation available.
CCDSiCCDS2342.1 [Q14790-1]
CCDS2343.1 [Q14790-2]
CCDS2345.1 [Q14790-5]
CCDS42798.1 [Q14790-9]
CCDS42799.1 [Q14790-4]
RefSeqiNP_001073593.1, NM_001080124.1 [Q14790-2]
NP_001073594.1, NM_001080125.1 [Q14790-9]
NP_001219.2, NM_001228.4 [Q14790-4]
NP_203519.1, NM_033355.3 [Q14790-1]
NP_203520.1, NM_033356.3 [Q14790-2]
NP_203522.1, NM_033358.3 [Q14790-5]
XP_005246943.1, XM_005246886.1
XP_005246944.1, XM_005246887.1 [Q14790-1]
XP_005246945.1, XM_005246888.1 [Q14790-1]
XP_005246946.1, XM_005246889.1 [Q14790-1]
XP_005246947.1, XM_005246890.3 [Q14790-1]
XP_005246948.1, XM_005246891.4 [Q14790-1]
XP_005246949.1, XM_005246892.1 [Q14790-2]
XP_006712852.1, XM_006712789.1 [Q14790-1]
XP_006712853.1, XM_006712790.3 [Q14790-1]
XP_006712856.1, XM_006712793.2 [Q14790-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F9EX-ray2.90A/C/E/G/I/K222-374[»]
B/D/F/H/J/L390-478[»]
1I4EX-ray3.00B222-479[»]
1QDUX-ray2.80A/C/E/G/I/K222-374[»]
B/D/F/H/J/L390-477[»]
1QTNX-ray1.20A211-374[»]
B385-479[»]
2C2ZX-ray1.95A218-374[»]
B376-479[»]
2FUNX-ray3.00B/D222-479[»]
2K7ZNMR-A217-479[»]
2Y1LX-ray1.80A/C218-374[»]
B/D376-479[»]
3H11X-ray1.90B217-479[»]
3KJNX-ray1.80A211-374[»]
B385-479[»]
3KJQX-ray1.80A211-374[»]
B385-479[»]
4JJ7X-ray1.18A217-479[»]
4PRZX-ray2.12A217-479[»]
4PS1X-ray1.73A/B/C/D217-479[»]
4ZBWX-ray2.20A/B2-188[»]
5H31X-ray3.17A/B/C/D1-188[»]
5H33X-ray3.60A/B1-188[»]
5JQEX-ray3.16A1-186[»]
5L08electron microscopy4.60A/B/C/D/E/F/G/H/I1-184[»]
6AGWX-ray2.09A1-180[»]
6PX9X-ray2.88A/B/C/D/E/F217-479[»]
BMRBiQ14790
SMRiQ14790
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107291, 168 interactors
ComplexPortaliCPX-1907, Ripoptosome
CPX-975, Caspase-8 complex
CORUMiQ14790
DIPiDIP-30915N
ELMiQ14790
IntActiQ14790, 130 interactors
MINTiQ14790
STRINGi9606.ENSP00000351273

Chemistry databases

BindingDBiQ14790
ChEMBLiCHEMBL3776
DrugBankiDB12651, Bardoxolone
DB11752, Bryostatin 1
GuidetoPHARMACOLOGYi1624

Protein family/group databases

MEROPSiC14.009

PTM databases

iPTMnetiQ14790
PhosphoSitePlusiQ14790
SwissPalmiQ14790

Genetic variation databases

BioMutaiCASP8
DMDMi2493531

Proteomic databases

CPTACiCPTAC-794
CPTAC-795
EPDiQ14790
jPOSTiQ14790
MassIVEiQ14790
MaxQBiQ14790
PaxDbiQ14790
PeptideAtlasiQ14790
PRIDEiQ14790
ProteomicsDBi60172 [Q14790-1]
60173 [Q14790-2]
60174 [Q14790-3]
60175 [Q14790-4]
60176 [Q14790-5]
60177 [Q14790-6]
60178 [Q14790-7]
60179 [Q14790-8]
60180 [Q14790-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		697, 1491 antibodies

The DNASU plasmid repository

More...DNASUi		841

Genome annotation databases

EnsembliENST00000264274; ENSP00000264274; ENSG00000064012 [Q14790-3]
ENST00000264275; ENSP00000264275; ENSG00000064012 [Q14790-4]
ENST00000323492; ENSP00000325722; ENSG00000064012 [Q14790-2]
ENST00000358485; ENSP00000351273; ENSG00000064012 [Q14790-9]
ENST00000392258; ENSP00000376087; ENSG00000064012 [Q14790-5]
ENST00000392263; ENSP00000376091; ENSG00000064012 [Q14790-2]
ENST00000432109; ENSP00000412523; ENSG00000064012 [Q14790-1]
ENST00000673742; ENSP00000501268; ENSG00000064012 [Q14790-1]
GeneIDi841
KEGGihsa:841
UCSCiuc002uxo.2, human [Q14790-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		841
DisGeNETi841

GeneCards: human genes, protein and diseases

More...GeneCardsi		CASP8
HGNCiHGNC:1509, CASP8
HPAiENSG00000064012, Tissue enhanced (blood)
MalaCardsiCASP8
MIMi211980, phenotype
601763, gene
607271, phenotype
neXtProtiNX_Q14790
OpenTargetsiENSG00000064012
Orphaneti210159, Adult hepatocellular carcinoma
275517, Autoimmune lymphoproliferative syndrome with recurrent viral infections
PharmGKBiPA26092
VEuPathDBiHostDB:ENSG00000064012.21

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3573, Eukaryota
GeneTreeiENSGT00940000160319
HOGENOMiCLU_036904_4_2_1
InParanoidiQ14790
OMAiSDKVYRM
OrthoDBi939331at2759
PhylomeDBiQ14790
TreeFamiTF102023

Enzyme and pathway databases

BRENDAi3.4.22.61, 2681
PathwayCommonsiQ14790
ReactomeiR-HSA-111465, Apoptotic cleavage of cellular proteins
R-HSA-140534, Caspase activation via Death Receptors in the presence of ligand
R-HSA-168638, NOD1/2 Signaling Pathway
R-HSA-2562578, TRIF-mediated programmed cell death
R-HSA-264870, Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-3371378, Regulation by c-FLIP
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357786, TNFR1-induced proapoptotic signaling
R-HSA-5357905, Regulation of TNFR1 signaling
R-HSA-5660668, CLEC7A/inflammasome pathway
R-HSA-5675482, Regulation of necroptotic cell death
R-HSA-69416, Dimerization of procaspase-8
R-HSA-75108, Activation, myristolyation of BID and translocation to mitochondria
R-HSA-75153, Apoptotic execution phase
R-HSA-75157, FasL/ CD95L signaling
R-HSA-75158, TRAIL signaling
R-HSA-9013957, TLR3-mediated TICAM1-dependent programmed cell death
R-HSA-933543, NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
R-HSA-9686347, Microbial modulation of RIPK1-mediated regulated necrosis
R-HSA-9693928, Defective RIPK1-mediated regulated necrosis
SignaLinkiQ14790
SIGNORiQ14790

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		841, 15 hits in 1006 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CASP8, human
EvolutionaryTraceiQ14790

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Caspase_8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		841
PharosiQ14790, Tchem

Protein Ontology

More...PROi		PR:Q14790
RNActiQ14790, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000064012, Expressed in small intestine Peyer's patch and 211 other tissues
ExpressionAtlasiQ14790, baseline and differential
GenevisibleiQ14790, HS

Family and domain databases

CDDicd00032, CASc, 1 hit
InterProiView protein in InterPro
IPR033170, Caspase-8
IPR029030, Caspase-like_dom_sf
IPR033139, Caspase_cys_AS
IPR016129, Caspase_his_AS
IPR011029, DEATH-like_dom_sf
IPR001875, DED_dom
IPR002398, Pept_C14
IPR002138, Pept_C14_p10
IPR001309, Pept_C14_p20
IPR015917, Pept_C14A
PANTHERiPTHR10454, PTHR10454, 1 hit
PTHR10454:SF162, PTHR10454:SF162, 1 hit
PfamiView protein in Pfam
PF01335, DED, 2 hits
PRINTSiPR00376, IL1BCENZYME
SMARTiView protein in SMART
SM00115, CASc, 1 hit
SM00031, DED, 2 hits
SUPFAMiSSF47986, SSF47986, 2 hits
SSF52129, SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122, CASPASE_CYS, 1 hit
PS01121, CASPASE_HIS, 1 hit
PS50207, CASPASE_P10, 1 hit
PS50208, CASPASE_P20, 1 hit
PS50168, DED, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCASP8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14790
Secondary accession number(s): O14676
, Q14791, Q14792, Q14793, Q14794, Q14795, Q14796, Q15780, Q15806, Q53TT5, Q8TDI1, Q8TDI2, Q8TDI3, Q8TDI4, Q8TDI5, Q96T22, Q9C0K4, Q9UQ81
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 2, 2021
This is version 245 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again