Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (13 Feb 2019)
Sequence version 1 (01 Nov 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Intercellular adhesion molecule 4

Gene

ICAM4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • integrin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionBlood group antigen
Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-216083 Integrin cell surface interactions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Intercellular adhesion molecule 4
Short name:
ICAM-4
Alternative name(s):
Landsteiner-Wiener blood group glycoprotein
Short name:
LW blood group protein
CD_antigen: CD242
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ICAM4
Synonyms:LW
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000105371.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:5347 ICAM4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614088 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14773

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini23 – 240ExtracellularSequence analysisAdd BLAST218
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei241 – 261HelicalSequence analysisAdd BLAST21
Topological domaini262 – 271CytoplasmicSequence analysis10

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
3386

MalaCards human disease database

More...
MalaCardsi
ICAM4
MIMi111250 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000105371

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29595

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ICAM4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2497309

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001479623 – 271Intercellular adhesion molecule 4Add BLAST249

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi68N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi69 ↔ 117By similarity
Disulfide bondi69 ↔ 113PROSITE-ProRule annotationBy similarity
Disulfide bondi73 ↔ 117By similarity
Glycosylationi78N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi153 ↔ 210By similarity
Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi223N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N- and O-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14773

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14773

PeptideAtlas

More...
PeptideAtlasi
Q14773

PRoteomics IDEntifications database

More...
PRIDEi
Q14773

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60165
60166 [Q14773-2]
60167 [Q14773-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q14773-1 [Q14773-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Erythrocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000105371 Expressed in 84 organ(s), highest expression level in liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14773 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14773 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109613, 18 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q14773

Protein interaction database and analysis system

More...
IntActi
Q14773, 9 interactors

Molecular INTeraction database

More...
MINTi
Q14773

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342114

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14773

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14773

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini62 – 124Ig-like C2-type 1Add BLAST63
Domaini146 – 217Ig-like C2-type 2Add BLAST72

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ICAM family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JBEM Eukaryota
ENOG4111651 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162431

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112993

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052076

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14773

KEGG Orthology (KO)

More...
KOi
K06581

Identification of Orthologs from Complete Genome Data

More...
OMAi
LRCHVTH

Database of Orthologous Groups

More...
OrthoDBi
1345330at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14773

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013768 ICAM_N
IPR003987 ICAM_VCAM_N
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03921 ICAM_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01472 ICAMVCAM1

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform Long (identifier: Q14773-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV
60 70 80 90 100
RMSPEFVAVQ PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ
110 120 130 140 150
LLDVRAWSSL AHCLVTCAGK TRWATSRITA YKPPHSVILE PPVLKGRKYT
160 170 180 190 200
LRCHVTQVFP VGYLVVTLRH GSRVIYSESL ERFTGLDLAN VTLTYEFAAG
210 220 230 240 250
PRDFWQPVIC HARLNLDGLV VRNSSAPITL MLAWSPAPTA LASGSIAALV
260 270
GILLTVGAAY LCKCLAMKSQ A
Length:271
Mass (Da):29,265
Last modified:November 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2F6BC8BABD79E615
GO
Isoform Short (identifier: Q14773-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL

Show »
Length:237
Mass (Da):25,931
Checksum:iF74416D3FB52ADB2
GO
Isoform 3 (identifier: Q14773-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-271: KPPHSVILEP...CKCLAMKSQA → SVPGGLLGGD...QSGEMAIHGG

Show »
Length:272
Mass (Da):29,649
Checksum:i991DE1707703CA19
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14 – 29AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538 (PubMed:8202485).CuratedAdd BLAST16
Sequence conflicti14 – 29AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537 (PubMed:8202485).CuratedAdd BLAST16

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Responsible for the Landsteiner-Wiener blood group system [MIMi:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_003912100Q → R in LW(B). 1 PublicationCorresponds to variant dbSNP:rs77493670EnsemblClinVar.1
Natural variantiVAR_038721208V → L1 PublicationCorresponds to variant dbSNP:rs36023325Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043229132 – 271KPPHS…MKSQA → SVPGGLLGGDPEAWKPGHLF RKPGALHRPGSGQRDLDLRV CCWTPRLLAARDLPRAPQSR RPGGPQQLGTHYTDARLEPR AHSFGLRFHRCPCRDPPHCG RCVPMQVPSYEVPGVKGDVL CRLSEKKRNMKQSGEMAIHG G in isoform 3. 2 PublicationsAdd BLAST140
Alternative sequenceiVSP_002519233 – 271AWSPA…MKSQA → GEAPL in isoform Short. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L27671 mRNA Translation: AAA59538.1
L27670 mRNA Translation: AAA59537.1
X93093 Genomic DNA Translation: CAA63646.1
BT009816 mRNA Translation: AAP88818.1
DQ011692 Genomic DNA Translation: AAY16986.1
AC011511 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84089.1
BC000046 mRNA Translation: AAH00046.1
BC029364 mRNA Translation: AAH29364.1
S78852 mRNA Translation: AAB35046.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12232.1 [Q14773-1]
CCDS32904.1 [Q14773-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
I52612
I59300
I80159

NCBI Reference Sequences

More...
RefSeqi
NP_001034221.1, NM_001039132.2 [Q14773-3]
NP_001535.1, NM_001544.4 [Q14773-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.706750

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000340992; ENSP00000342114; ENSG00000105371 [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371 [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371 [Q14773-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3386

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3386

UCSC genome browser

More...
UCSCi
uc002mns.3 human [Q14773-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27671 mRNA Translation: AAA59538.1
L27670 mRNA Translation: AAA59537.1
X93093 Genomic DNA Translation: CAA63646.1
BT009816 mRNA Translation: AAP88818.1
DQ011692 Genomic DNA Translation: AAY16986.1
AC011511 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84089.1
BC000046 mRNA Translation: AAH00046.1
BC029364 mRNA Translation: AAH29364.1
S78852 mRNA Translation: AAB35046.1
CCDSiCCDS12232.1 [Q14773-1]
CCDS32904.1 [Q14773-3]
PIRiI52612
I59300
I80159
RefSeqiNP_001034221.1, NM_001039132.2 [Q14773-3]
NP_001535.1, NM_001544.4 [Q14773-1]
UniGeneiHs.706750

3D structure databases

ProteinModelPortaliQ14773
SMRiQ14773
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109613, 18 interactors
CORUMiQ14773
IntActiQ14773, 9 interactors
MINTiQ14773
STRINGi9606.ENSP00000342114

Polymorphism and mutation databases

BioMutaiICAM4
DMDMi2497309

Proteomic databases

jPOSTiQ14773
PaxDbiQ14773
PeptideAtlasiQ14773
PRIDEiQ14773
ProteomicsDBi60165
60166 [Q14773-2]
60167 [Q14773-3]
TopDownProteomicsiQ14773-1 [Q14773-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3386
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340992; ENSP00000342114; ENSG00000105371 [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371 [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371 [Q14773-2]
GeneIDi3386
KEGGihsa:3386
UCSCiuc002mns.3 human [Q14773-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3386
DisGeNETi3386
EuPathDBiHostDB:ENSG00000105371.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ICAM4
HGNCiHGNC:5347 ICAM4
MalaCardsiICAM4
MIMi111250 phenotype
614088 gene
neXtProtiNX_Q14773
OpenTargetsiENSG00000105371
PharmGKBiPA29595

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JBEM Eukaryota
ENOG4111651 LUCA
GeneTreeiENSGT00940000162431
HOGENOMiHOG000112993
HOVERGENiHBG052076
InParanoidiQ14773
KOiK06581
OMAiLRCHVTH
OrthoDBi1345330at2759
PhylomeDBiQ14773

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-216083 Integrin cell surface interactions

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3386

Protein Ontology

More...
PROi
PR:Q14773

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000105371 Expressed in 84 organ(s), highest expression level in liver
ExpressionAtlasiQ14773 baseline and differential
GenevisibleiQ14773 HS

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR013768 ICAM_N
IPR003987 ICAM_VCAM_N
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
PfamiView protein in Pfam
PF03921 ICAM_N, 1 hit
PRINTSiPR01472 ICAMVCAM1
SUPFAMiSSF48726 SSF48726, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiICAM4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14773
Secondary accession number(s): A0M8X2
, Q14771, Q14772, Q16375, Q9BWR0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: February 13, 2019
This is version 173 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Blood group antigen proteins
    Nomenclature of blood group antigens and list of entries
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again