Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (22 Apr 2020)
Sequence version 2 (10 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phosphatidate phosphatase LPIN1

Gene

LPIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays important roles in controlling the metabolism of fatty acids at different levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression (By similarity). Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol (By similarity).By similarity

Miscellaneous

May represent a candidate gene for human lipodysytropy syndromes.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication, Mn2+1 PublicationNote: Mg2+ and, at a lesser extent, Mn2+.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Potently inhibited by sphingolipids, in particular, the sphingoid bases sphinganine and sphingosine and ceramide-1-phosphate. Inhibited by concentrations of Mg2+ and Mn2+ above their optimums and by Ca2+, Zn2+, N-ethylmaleimide and propranolol.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.35 mM for phosphatidate (isoform 1)
  2. KM=0.24 mM for phosphatidate (isoform 3)
  3. KM=0.11 mM for phosphatidate (isoform 4)

    Temperature dependencei

    Optimum temperature is 40 degrees Celsius. Thermolabile above 40 degrees Celsius and essentially inactive at 60 degrees Celsius.

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase
    Biological processFatty acid metabolism, Lipid metabolism, Transcription, Transcription regulation

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.3.4 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-1483191 Synthesis of PC
    R-HSA-1483213 Synthesis of PE
    R-HSA-4419969 Depolymerisation of the Nuclear Lamina
    R-HSA-75109 Triglyceride biosynthesis

    SIGNOR Signaling Network Open Resource

    More...
    SIGNORi
    Q14693

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000000881 [Q14693-1]
    SLP:000000882 [Q14693-3]
    SLP:000000883 [Q14693-4]

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Phosphatidate phosphatase LPIN1 (EC:3.1.3.4)
    Alternative name(s):
    Lipin-1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:LPIN1
    Synonyms:KIAA0188
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:13345 LPIN1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    605518 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q14693

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Myoglobinuria, acute recurrent, autosomal recessive (ARARM)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionRecurrent myoglobinuria is characterized by recurrent attacks of rhabdomyolysis (necrosis or disintegration of skeletal muscle) associated with muscle pain and weakness and followed by excretion of myoglobin in the urine. Renal failure may occasionally occur.
    Related information in OMIM

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    23175

    MalaCards human disease database

    More...
    MalaCardsi
    LPIN1
    MIMi268200 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000134324

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    99845 Genetic recurrent myoglobinuria

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA30436

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q14693 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    LPIN1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    23831266

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002098791 – 890Phosphatidate phosphatase LPIN1Add BLAST890

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei106PhosphoserineBy similarity1
    Modified residuei150PhosphoserineBy similarity1
    Modified residuei252PhosphoserineBy similarity1
    Modified residuei254PhosphoserineBy similarity1
    Modified residuei260PhosphoserineBy similarity1
    Modified residuei264PhosphothreonineBy similarity1
    Modified residuei294PhosphoserineBy similarity1
    Modified residuei434PhosphoserineBy similarity1
    Modified residuei438PhosphoserineBy similarity1
    Modified residuei449PhosphoserineBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki565Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
    Cross-linki595Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
    Modified residuei600PhosphoserineBy similarity1
    Modified residuei601PhosphoserineBy similarity1
    Modified residuei887PhosphoserineBy similarity1
    Modified residuei889PhosphoserineBy similarity1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    Phosphorylated at multiple sites in response to insulin. Phosphorylation is controlled by the mTOR signaling pathway. Phosphorylation is decreased by epinephrine. Phosphorylation may not directly affect the catalytic activity but may regulate the localization. Dephosphorylated by the CTDNEP1-CNEP1R1 complex (By similarity).By similarity
    Sumoylated.By similarity

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q14693

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q14693

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q14693

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q14693

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q14693

    PeptideAtlas

    More...
    PeptideAtlasi
    Q14693

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q14693

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    15159
    17975
    2078
    24603
    3982
    4174
    60131 [Q14693-1]

    PTM databases

    DEPOD human dephosphorylation database

    More...
    DEPODi
    Q14693

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q14693

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q14693

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Specifically expressed in skeletal muscle. Also abundant in adipose tissue. Lower levels in some portions of the digestive tract.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000134324 Expressed in sperm and 235 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q14693 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q14693 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    ENSG00000134324 Tissue enhanced (skeletal)

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts (via LXXIL motif) with PPARA.

    Interacts with PPARGC1A. Interaction with PPARA and PPARGC1A leads to the formation of a complex that modulates gene transcription.

    Interacts with MEF2C.

    By similarity

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    116787, 15 interactors

    CORUM comprehensive resource of mammalian protein complexes

    More...
    CORUMi
    Q14693

    Protein interaction database and analysis system

    More...
    IntActi
    Q14693, 8 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000397908

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q14693 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q14693

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 108N-LIPAdd BLAST108
    Regioni624 – 830C-LIPAdd BLAST207

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi153 – 158Nuclear localization signalSequence analysis6
    Motifi678 – 682DXDXT motif5
    Motifi689 – 693LXXIL motif5

    Compositional bias

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi147 – 150Poly-Ser4
    Compositional biasi598 – 601Poly-Ser4

    <p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    Contains one Leu-Xaa-Xaa-Ile-Leu (LXXIL), a transcriptional binding motif, which mediates interaction with PPARA.By similarity

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the lipin family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2116 Eukaryota
    COG5083 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157219

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_595738_0_0_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q14693

    KEGG Orthology (KO)

    More...
    KOi
    K15728

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    HSDGEWS

    Database of Orthologous Groups

    More...
    OrthoDBi
    866929at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q14693

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF314095

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR036412 HAD-like_sf
    IPR026058 LIPIN
    IPR031703 Lipin_mid
    IPR007651 Lipin_N
    IPR013209 LNS2
    IPR031315 LNS2/PITP
    IPR028794 LPIN1

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR12181 PTHR12181, 2 hits
    PTHR12181:SF10 PTHR12181:SF10, 2 hits

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF16876 Lipin_mid, 1 hit
    PF04571 Lipin_N, 1 hit
    PF08235 LNS2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00775 LNS2, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF56784 SSF56784, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 7 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q14693-1) [UniParc]FASTAAdd to basket
    Also known as: Alpha

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MNYVGQLAGQ VFVTVKELYK GLNPATLSGC IDIIVIRQPN GNLQCSPFHV
    60 70 80 90 100
    RFGKMGVLRS REKVVDIEIN GESVDLHMKL GDNGEAFFVQ ETDNDQEVIP
    110 120 130 140 150
    MHLATSPILS EGASRMECQL KRGSVDRMRG LDPSTPAQVI APSETPSSSS
    160 170 180 190 200
    VVKKRRKRRR KSQLDSLKRD DNMNTSEDED MFPIEMSSDE AMELLESSRT
    210 220 230 240 250
    LPNDIPPFQD DIPEENLSLA VIYPQSASYP NSDREWSPTP SPSGSRPSTP
    260 270 280 290 300
    KSDSELVSKS TERTGQKNPE MLWLWGELPQ AAKSSSPHKM KESSPLSSRK
    310 320 330 340 350
    ICDKSHFQAI HSESSDTFSD QSPTLVGGAL LDQNKPQTEM QFVNEEDLET
    360 370 380 390 400
    LGAAAPLLPM IEELKPPSAS VVQTANKTDS PSRKRDKRSR HLGADGVYLD
    410 420 430 440 450
    DLTDMDPEVA ALYFPKNGDP SGLAKHASDN GARSANQSPQ SVGSSGVDSG
    460 470 480 490 500
    VESTSDGLRD LPSIAISLCG GLSDHREITK DAFLEQAVSY QQFVDNPAII
    510 520 530 540 550
    DDPNLVVKIG SKYYNWTTAA PLLLAMQAFQ KPLPKATVES IMRDKMPKKG
    560 570 580 590 600
    GRWWFSWRGR NTTIKEESKP EQCLAGKAHS TGEQPPQLSL ATRVKHESSS
    610 620 630 640 650
    SDEERAAAKP SNAGHLPLLP NVSYKKTLRL TSEQLKSLKL KNGPNDVVFS
    660 670 680 690 700
    VTTQYQGTCR CEGTIYLWNW DDKVIISDID GTITRSDTLG HILPTLGKDW
    710 720 730 740 750
    THQGIAKLYH KVSQNGYKFL YCSARAIGMA DMTRGYLHWV NERGTVLPQG
    760 770 780 790 800
    PLLLSPSSLF SALHREVIEK KPEKFKVQCL TDIKNLFFPN TEPFYAAFGN
    810 820 830 840 850
    RPADVYSYKQ VGVSLNRIFT VNPKGELVQE HAKTNISSYV RLCEVVDHVF
    860 870 880 890
    PLLKRSHSSD FPCSDTFSNF TFWREPLPPF ENQDIHSASA
    Length:890
    Mass (Da):98,664
    Last modified:October 10, 2002 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i781761FC47E9CEE7
    GO
    Isoform 2 (identifier: Q14693-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRVQTM

    Show »
    Length:896
    Mass (Da):99,367
    Checksum:iCBE905D33C8D62CD
    GO
    Isoform 3 (identifier: Q14693-3) [UniParc]FASTAAdd to basket
    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         241-241: S → SSLVDCKRTAPHLAVAAEGGLSSSCPPQSSLFHPSES

    Show »
    Length:926
    Mass (Da):102,313
    Checksum:i3CAB6B85233F6AAD
    GO
    Isoform 4 (identifier: Q14693-4) [UniParc]FASTAAdd to basket
    Also known as: Gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         535-535: K → KSSCLSYLHVILDAIRFCFSKIFNAQI

    Show »
    Length:916
    Mass (Da):101,636
    Checksum:iA1594A83FE86D930
    GO
    Isoform 5 (identifier: Q14693-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRVQTM
         241-241: S → SSLVDCKRTAPHLAVAAEGGLSSSCPPQSSLFHPSES

    Show »
    Length:932
    Mass (Da):103,016
    Checksum:iDC45B264870384D8
    GO
    Isoform 6 (identifier: Q14693-6) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSRVQTM
         241-241: S → SSLVDCKRTAPHLAVAAEGGLSSSCPPQSSLFHPSES
         417-417: N → K
         418-890: Missing.

    Show »
    Length:459
    Mass (Da):50,528
    Checksum:iDC0514AD1A5C4922
    GO
    Isoform 7 (identifier: Q14693-7) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGEQDGIRSSSWETSQGKSSPDSAWSWIPIMRDPGWIRNVWSSNINVQTM
         241-241: S → SSLVDCKRTAPHLAVAAEGGLSSSCPPQSSLFHPSES

    Show »
    Length:975
    Mass (Da):107,861
    Checksum:iFE3F7C4BBA831395
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    A0A0A0MS66A0A0A0MS66_HUMAN
    Phosphatidate phosphatase LPIN1
    LPIN1
    701Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H7C3T1H7C3T1_HUMAN
    Phosphatidate phosphatase LPIN1
    LPIN1
    194Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9IYP2C9IYP2_HUMAN
    Phosphatidate phosphatase LPIN1
    LPIN1
    96Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9J278C9J278_HUMAN
    Phosphatidate phosphatase LPIN1
    LPIN1
    28Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA11505 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
    The sequence BAG57200 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence BAG57885 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
    The sequence BAG57957 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence BC018071 differs from that shown. Reason: Frameshift.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti171D → G in BC018071 (PubMed:15489334).Curated1
    Sequence conflicti210D → G in BAG57885 (PubMed:14702039).Curated1
    Sequence conflicti316D → Y in BAH13844 (PubMed:14702039).Curated1
    Sequence conflicti535K → R in BAH13844 (PubMed:14702039).Curated1
    Sequence conflicti592T → I in BAG57885 (PubMed:14702039).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03587456G → E in a colorectal cancer sample; somatic mutation. 1 Publication1
    Natural variantiVAR_013885610P → S1 PublicationCorresponds to variant dbSNP:rs4669781Ensembl.1
    Natural variantiVAR_054878637S → T1 PublicationCorresponds to variant dbSNP:rs17852755Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0455331M → MSRVQTM in isoform 2, isoform 5 and isoform 6. 2 Publications1
    Alternative sequenceiVSP_0553841M → MGEQDGIRSSSWETSQGKSS PDSAWSWIPIMRDPGWIRNV WSSNINVQTM in isoform 7. Curated1
    Alternative sequenceiVSP_053970241S → SSLVDCKRTAPHLAVAAEGG LSSSCPPQSSLFHPSES in isoform 3, isoform 5, isoform 6 and isoform 7. 2 Publications1
    Alternative sequenceiVSP_055361417N → K in isoform 6. 1 Publication1
    Alternative sequenceiVSP_055362418 – 890Missing in isoform 6. 1 PublicationAdd BLAST473
    Alternative sequenceiVSP_053971535K → KSSCLSYLHVILDAIRFCFS KIFNAQI in isoform 4. 1 Publication1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    D80010 mRNA Translation: BAA11505.1 Different initiation.
    AK290235 mRNA Translation: BAF82924.1
    AK293787 mRNA Translation: BAG57200.1 Different initiation.
    AK294742 mRNA Translation: BAG57885.1 Different initiation.
    AK294853 mRNA Translation: BAG57957.1 Different initiation.
    AK302922 mRNA Translation: BAH13844.1
    AC012456 Genomic DNA Translation: AAY14695.1
    AC106875 Genomic DNA No translation available.
    CH471053 Genomic DNA Translation: EAX00918.1
    CH471053 Genomic DNA Translation: EAX00920.1
    BC018071 mRNA No translation available.
    BC030537 mRNA Translation: AAH30537.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS1682.1 [Q14693-1]
    CCDS58699.1 [Q14693-7]
    CCDS58701.1 [Q14693-2]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001248356.1, NM_001261427.1 [Q14693-2]
    NP_001248357.1, NM_001261428.1 [Q14693-7]
    NP_001248358.1, NM_001261429.1
    NP_663731.1, NM_145693.2 [Q14693-1]
    XP_006711933.1, XM_006711870.3 [Q14693-5]
    XP_006711934.1, XM_006711871.2
    XP_006711935.1, XM_006711872.2 [Q14693-3]
    XP_006711937.1, XM_006711874.2
    XP_011508636.1, XM_011510334.2 [Q14693-5]
    XP_011508637.1, XM_011510335.2 [Q14693-3]
    XP_011508638.1, XM_011510336.2 [Q14693-3]
    XP_016859113.1, XM_017003624.1 [Q14693-3]
    XP_016859114.1, XM_017003625.1 [Q14693-3]
    XP_016859117.1, XM_017003628.1 [Q14693-1]
    XP_016859118.1, XM_017003629.1 [Q14693-1]
    XP_016859119.1, XM_017003630.1 [Q14693-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000256720; ENSP00000256720; ENSG00000134324 [Q14693-1]
    ENST00000396097; ENSP00000379404; ENSG00000134324 [Q14693-5]
    ENST00000396098; ENSP00000379405; ENSG00000134324 [Q14693-6]
    ENST00000425416; ENSP00000401522; ENSG00000134324 [Q14693-2]
    ENST00000449576; ENSP00000397908; ENSG00000134324 [Q14693-7]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    23175

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:23175

    UCSC genome browser

    More...
    UCSCi
    uc002rbs.5 human [Q14693-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    D80010 mRNA Translation: BAA11505.1 Different initiation.
    AK290235 mRNA Translation: BAF82924.1
    AK293787 mRNA Translation: BAG57200.1 Different initiation.
    AK294742 mRNA Translation: BAG57885.1 Different initiation.
    AK294853 mRNA Translation: BAG57957.1 Different initiation.
    AK302922 mRNA Translation: BAH13844.1
    AC012456 Genomic DNA Translation: AAY14695.1
    AC106875 Genomic DNA No translation available.
    CH471053 Genomic DNA Translation: EAX00918.1
    CH471053 Genomic DNA Translation: EAX00920.1
    BC018071 mRNA No translation available.
    BC030537 mRNA Translation: AAH30537.1
    CCDSiCCDS1682.1 [Q14693-1]
    CCDS58699.1 [Q14693-7]
    CCDS58701.1 [Q14693-2]
    RefSeqiNP_001248356.1, NM_001261427.1 [Q14693-2]
    NP_001248357.1, NM_001261428.1 [Q14693-7]
    NP_001248358.1, NM_001261429.1
    NP_663731.1, NM_145693.2 [Q14693-1]
    XP_006711933.1, XM_006711870.3 [Q14693-5]
    XP_006711934.1, XM_006711871.2
    XP_006711935.1, XM_006711872.2 [Q14693-3]
    XP_006711937.1, XM_006711874.2
    XP_011508636.1, XM_011510334.2 [Q14693-5]
    XP_011508637.1, XM_011510335.2 [Q14693-3]
    XP_011508638.1, XM_011510336.2 [Q14693-3]
    XP_016859113.1, XM_017003624.1 [Q14693-3]
    XP_016859114.1, XM_017003625.1 [Q14693-3]
    XP_016859117.1, XM_017003628.1 [Q14693-1]
    XP_016859118.1, XM_017003629.1 [Q14693-1]
    XP_016859119.1, XM_017003630.1 [Q14693-1]

    3D structure databases

    SMRiQ14693
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi116787, 15 interactors
    CORUMiQ14693
    IntActiQ14693, 8 interactors
    STRINGi9606.ENSP00000397908

    Chemistry databases

    SwissLipidsiSLP:000000881 [Q14693-1]
    SLP:000000882 [Q14693-3]
    SLP:000000883 [Q14693-4]

    PTM databases

    DEPODiQ14693
    iPTMnetiQ14693
    PhosphoSitePlusiQ14693

    Polymorphism and mutation databases

    BioMutaiLPIN1
    DMDMi23831266

    Proteomic databases

    EPDiQ14693
    jPOSTiQ14693
    MassIVEiQ14693
    MaxQBiQ14693
    PaxDbiQ14693
    PeptideAtlasiQ14693
    PRIDEiQ14693
    ProteomicsDBi15159
    17975
    2078
    24603
    3982
    4174
    60131 [Q14693-1]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    26865 445 antibodies

    The DNASU plasmid repository

    More...
    DNASUi
    23175

    Genome annotation databases

    EnsembliENST00000256720; ENSP00000256720; ENSG00000134324 [Q14693-1]
    ENST00000396097; ENSP00000379404; ENSG00000134324 [Q14693-5]
    ENST00000396098; ENSP00000379405; ENSG00000134324 [Q14693-6]
    ENST00000425416; ENSP00000401522; ENSG00000134324 [Q14693-2]
    ENST00000449576; ENSP00000397908; ENSG00000134324 [Q14693-7]
    GeneIDi23175
    KEGGihsa:23175
    UCSCiuc002rbs.5 human [Q14693-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    23175
    DisGeNETi23175

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    LPIN1
    HGNCiHGNC:13345 LPIN1
    HPAiENSG00000134324 Tissue enhanced (skeletal)
    MalaCardsiLPIN1
    MIMi268200 phenotype
    605518 gene
    neXtProtiNX_Q14693
    OpenTargetsiENSG00000134324
    Orphaneti99845 Genetic recurrent myoglobinuria
    PharmGKBiPA30436

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG2116 Eukaryota
    COG5083 LUCA
    GeneTreeiENSGT00940000157219
    HOGENOMiCLU_595738_0_0_1
    InParanoidiQ14693
    KOiK15728
    OMAiHSDGEWS
    OrthoDBi866929at2759
    PhylomeDBiQ14693
    TreeFamiTF314095

    Enzyme and pathway databases

    BRENDAi3.1.3.4 2681
    ReactomeiR-HSA-1483191 Synthesis of PC
    R-HSA-1483213 Synthesis of PE
    R-HSA-4419969 Depolymerisation of the Nuclear Lamina
    R-HSA-75109 Triglyceride biosynthesis
    SIGNORiQ14693

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    LPIN1 human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    LPIN1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    23175
    PharosiQ14693 Tbio

    Protein Ontology

    More...
    PROi
    PR:Q14693
    RNActiQ14693 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000134324 Expressed in sperm and 235 other tissues
    ExpressionAtlasiQ14693 baseline and differential
    GenevisibleiQ14693 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR036412 HAD-like_sf
    IPR026058 LIPIN
    IPR031703 Lipin_mid
    IPR007651 Lipin_N
    IPR013209 LNS2
    IPR031315 LNS2/PITP
    IPR028794 LPIN1
    PANTHERiPTHR12181 PTHR12181, 2 hits
    PTHR12181:SF10 PTHR12181:SF10, 2 hits
    PfamiView protein in Pfam
    PF16876 Lipin_mid, 1 hit
    PF04571 Lipin_N, 1 hit
    PF08235 LNS2, 1 hit
    SMARTiView protein in SMART
    SM00775 LNS2, 1 hit
    SUPFAMiSSF56784 SSF56784, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLPIN1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14693
    Secondary accession number(s): A8MU38
    , B4DET9, B4DGS4, B4DGZ6, B5MC18, B7Z858, D6W506, E7ESE7, F5GY24, Q53T25
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: October 10, 2002
    Last modified: April 22, 2020
    This is version 170 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again