Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pumilio homolog 1

Gene

PUM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. Binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE) (PubMed:21572425, PubMed:18328718, PubMed:21653694, PubMed:21397187). Mediates post-transcriptional repression of transcripts via different mechanisms: acts via direct recruitment of the CCR4-POP2-NOT deadenylase leading to translational inhibition and mRNA degradation (PubMed:22955276). Also mediates deadenylation-independent repression by promoting accessibility of miRNAs (PubMed:18776931, PubMed:20818387, PubMed:20860814, PubMed:22345517). Following growth factor stimulation, phosphorylated and binds to the 3'-UTR of CDKN1B/p27 mRNA, inducing a local conformational change that exposes miRNA-binding sites, promoting association of miR-221 and miR-222, efficient suppression of CDKN1B/p27 expression, and rapid entry to the cell cycle (PubMed:20818387). Acts as a post-transcriptional repressor of E2F3 mRNAs by binding to its 3'-UTR and facilitating miRNA regulation (PubMed:22345517, PubMed:29474920). Represses a program of genes necessary to maintain genomic stability such as key mitotic, DNA repair and DNA replication factors. Its ability to repress those target mRNAs is regulated by the lncRNA NORAD (non-coding RNA activated by DNA damage) which, due to its high abundance and multitude of PUMILIO binding sites, is able to sequester a significant fraction of PUM1 and PUM2 in the cytoplasm (PubMed:26724866). Involved in neuronal functions by regulating ATXN1 mRNA levels: acts by binding to the 3'-UTR of ATXN1 transcripts, leading to their down-regulation independently of the miRNA machinery (PubMed:25768905, PubMed:29474920). Plays a role in cytoplasmic sensing of viral infection (PubMed:25340845). In testis, acts as a post-transcriptional regulator of spermatogenesis by binding to the 3'-UTR of mRNAs coding for regulators of p53/TP53. Involved in embryonic stem cell renewal by facilitating the exit from the ground state: acts by targeting mRNAs coding for naive pluripotency transcription factors and accelerates their down-regulation at the onset of differentiation (By similarity). Binds specifically to miRNA MIR199A precursor, with PUM2, regulates miRNA MIR199A expression at a postranscriptional level (PubMed:28431233).By similarity14 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • miRNA binding Source: UniProtKB
  • mRNA 3'-UTR binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processDifferentiation, Spermatogenesis, Translation regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-432722 Golgi Associated Vesicle Biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pumilio homolog 1Curated
Short name:
HsPUM
Short name:
Pumilio-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PUM1Imported
Synonyms:KIAA00991 Publication, PUMH1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000134644.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14957 PUM1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607204 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14671

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spinocerebellar ataxia 47 (SCA47)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of spinocerebellar ataxia, a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA47 is an autosomal dominant disease with a highly variable phenotype and incomplete penetrance. Clinical features include developmental disability, ataxia, and seizures.
See also OMIM:617931
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0807841033T → S in SCA47; results in reduced PUM1 protein levels and decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1
Natural variantiVAR_0807851137R → W in SCA47; decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1
Natural variantiVAR_0807861145R → W in SCA47; results in reduced PUM1 protein levels and decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi209S → A: Does not affect RNA-binding activity. 1 Publication1
Mutagenesisi714S → A: Decreased RNA-binding activity. 1 Publication1
Mutagenesisi714S → E: Phospho-mimic mutant; persistent RNA-binding activity in quiescent cells. 1 Publication1
Mutagenesisi863 – 867SRFIQ → GRFIR: B and inds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi899 – 903NYVIQ → GYVIR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi935 – 939CRVIQ → GRVIR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi971 – 975NHVVQ → GHVVR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi1007 – 1011CRVIQ → GRVIR, ARVIR, SRVIR, TRVIR or CRVIR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi1007 – 1011CRVIQ → SRVIE: Specifically binds guanine-nucleotide in RNA target. 1 Publication5
Mutagenesisi1007C → N: Specifically binds uracil-nucleotide in RNA target. 1 Publication1
Mutagenesisi1043 – 1047NYVIQ → GYVIR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi1043 – 1044NY → SN: Changes the specificity for RNA; when associated with E-1047. 1 Publication2
Mutagenesisi1047Q → E: Changes the specificity for RNA; when associated with 1043-SN-1044. 1 Publication1
Mutagenesisi1079 – 1083SNVVE → GNVVR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5
Mutagenesisi1122 – 1126NYVVQ → GYVVR: Specifically binds cytosine-nucleotide in RNA target. 1 Publication5

Keywords - Diseasei

Disease mutation, Neurodegeneration, Spinocerebellar ataxia

Organism-specific databases

DisGeNET

More...
DisGeNETi
9698

MalaCards human disease database

More...
MalaCardsi
PUM1
MIMi617931 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000134644

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34042

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PUM1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
41688619

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000759172 – 1186Pumilio homolog 1Add BLAST1185

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei19PhosphoserineCombined sources1
Modified residuei75PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei106PhosphoserineCombined sources1
Modified residuei112PhosphothreonineCombined sources1
Modified residuei124PhosphoserineCombined sources1
Modified residuei159PhosphoserineCombined sources1
Modified residuei197PhosphoserineCombined sources1
Modified residuei209PhosphoserineCombined sources1 Publication1
Modified residuei229PhosphoserineCombined sources1
Modified residuei305PhosphoserineBy similarity1
Modified residuei514PhosphothreonineBy similarity1
Modified residuei709PhosphoserineCombined sources1
Modified residuei714Phosphoserine1 Publication1
Modified residuei796Omega-N-methylarginineCombined sources1
Modified residuei806PhosphoserineCombined sources1
Modified residuei822PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-714 promotes RNA-binding activity. Following growth factor stimulation phosphorylated at Ser-714, promoting binding to the 3'-UTR of CDKN1B/p27 mRNA.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14671

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14671

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14671

PeptideAtlas

More...
PeptideAtlasi
Q14671

PRoteomics IDEntifications database

More...
PRIDEi
Q14671

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60101
60102 [Q14671-2]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q14671

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14671

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14671

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, heart, kidney, muscle, intestine and stomach. Not expressed in cerebellum, corpus callosum, caudate nucleus, hippocampus, medulla oblongata and putamen. Expressed in all fetal tissues tested.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Strongly down-regulated in keratinocytes upon UVB irradiation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134644 Expressed in 243 organ(s), highest expression level in cerebral cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_PUM1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14671 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14671 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027424
HPA027449

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Recruits the CCR4-POP2-NOT deadenylase leading to translational inhibition and mRNA degradation (PubMed:22955276). In case of viral infection, interacts with DHX58 (PubMed:25340845). Interacts with TRIM71 (via NHL repeats) in an RNA-dependent manner (PubMed:23125361).3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115050, 91 interactors

Database of interacting proteins

More...
DIPi
DIP-29082N

Protein interaction database and analysis system

More...
IntActi
Q14671, 23 interactors

Molecular INTeraction database

More...
MINTi
Q14671

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000391723

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14671

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14671

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14671

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini828 – 1168PUM-HDPROSITE-ProRule annotationAdd BLAST341
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati848 – 883Pumilio 1PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati884 – 919Pumilio 2PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati920 – 955Pumilio 3PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati956 – 991Pumilio 4PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati992 – 1027Pumilio 5PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati1028 – 1063Pumilio 6PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati1064 – 1099Pumilio 7PROSITE-ProRule annotation1 PublicationAdd BLAST36
Repeati1103 – 1142Pumilio 8PROSITE-ProRule annotation1 PublicationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni863 – 867Adenine-nucleotide binding in RNA target1 Publication5
Regioni899 – 903Uracil-nucleotide binding in RNA target1 Publication5
Regioni935 – 939Adenine-nucleotide binding in RNA target1 Publication5
Regioni971 – 975Non-specific-nucleotide binding in RNA target1 Publication5
Regioni1007 – 1011Adenine-nucleotide binding in RNA target1 Publication5
Regioni1043 – 1047Uracil-nucleotide binding in RNA targetCombined sources2 Publications5
Regioni1079 – 1083Guanine-nucleotide binding in RNA targetCombined sources2 Publications5
Regioni1122 – 1126Uracil-nucleotide binding in RNA targetCombined sources2 Publications5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi393 – 613Ala-richAdd BLAST221
Compositional biasi475 – 523Gln-richAdd BLAST49
Compositional biasi642 – 815Ser-richAdd BLAST174

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The pumilio repeats mediate the association with RNA by packing together to form a right-handed superhelix that approximates a half donut. RNA-binding occurs on the concave side of the surface (PubMed:21397187). PUM1 is composed of 8 pumilio repeats of 36 residues; each repeat binds a single nucleotide in its RNA target. Residues at positions 12 and 16 of the pumilio repeat bind each RNA base via hydrogen bonding or van der Waals contacts with the Watson-Crick edge, while the amino acid at position 13 makes a stacking interaction. The recognition of RNA by pumilio repeats is base specific: cysteine and glutamine at position 12 and 16, respectively, bind adenine; asparagine and glutamine bind uracil; and serine and glutamate bind guanine (PubMed:21572425. PubMed:18328718, PubMed:21653694).4 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1488 Eukaryota
COG5099 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158079

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000238461

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG049462

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14671

KEGG Orthology (KO)

More...
KOi
K17943

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14671

TreeFam database of animal gene trees

More...
TreeFami
TF318160

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07920 Pumilio, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR033133 PUM-HD
IPR033712 Pumilio_RNA-bd
IPR001313 Pumilio_RNA-bd_rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00806 PUF, 8 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00025 Pumilio, 8 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50302 PUM, 8 hits
PS50303 PUM_HD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14671-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVACVLKRK AVLWQDSFSP HLKHHPQEPA NPNMPVVLTS GTGSQAQPQP
60 70 80 90 100
AANQALAAGT HSSPVPGSIG VAGRSQDDAM VDYFFQRQHG EQLGGGGSGG
110 120 130 140 150
GGYNNSKHRW PTGDNIHAEH QVRSMDELNH DFQALALEGR AMGEQLLPGK
160 170 180 190 200
KFWETDESSK DGPKGIFLGD QWRDSAWGTS DHSVSQPIMV QRRPGQSFHV
210 220 230 240 250
NSEVNSVLSP RSESGGLGVS MVEYVLSSSP GDSCLRKGGF GPRDADSDEN
260 270 280 290 300
DKGEKKNKGT FDGDKLGDLK EEGDVMDKTN GLPVQNGIDA DVKDFSRTPG
310 320 330 340 350
NCQNSANEVD LLGPNQNGSE GLAQLTSTNG AKPVEDFSNM ESQSVPLDPM
360 370 380 390 400
EHVGMEPLQF DYSGTQVPVD SAAATVGLFD YNSQQQLFQR PNALAVQQLT
410 420 430 440 450
AAQQQQYALA AAHQPHIGLA PAAFVPNPYI ISAAPPGTDP YTAGLAAAAT
460 470 480 490 500
LGPAVVPHQY YGVTPWGVYP ASLFQQQAAA AAAATNSANQ QTTPQAQQGQ
510 520 530 540 550
QQVLRGGASQ RPLTPNQNQQ GQQTDPLVAA AAVNSALAFG QGLAAGMPGY
560 570 580 590 600
PVLAPAAYYD QTGALVVNAG ARNGLGAPVR LVAPAPVIIS SSAAQAAVAA
610 620 630 640 650
AAASANGAAG GLAGTTNGPF RPLGTQQPQP QPQQQPNNNL ASSSFYGNNS
660 670 680 690 700
LNSNSQSSSL FSQGSAQPAN TSLGFGSSSS LGATLGSALG GFGTAVANSN
710 720 730 740 750
TGSGSRRDSL TGSSDLYKRT SSSLTPIGHS FYNGLSFSSS PGPVGMPLPS
760 770 780 790 800
QGPGHSQTPP PSLSSHGSSS SLNLGGLTNG SGRYISAAPG AEAKYRSASS
810 820 830 840 850
ASSLFSPSST LFSSSRLRYG MSDVMPSGRS RLLEDFRNNR YPNLQLREIA
860 870 880 890 900
GHIMEFSQDQ HGSRFIQLKL ERATPAERQL VFNEILQAAY QLMVDVFGNY
910 920 930 940 950
VIQKFFEFGS LEQKLALAER IRGHVLSLAL QMYGCRVIQK ALEFIPSDQQ
960 970 980 990 1000
NEMVRELDGH VLKCVKDQNG NHVVQKCIEC VQPQSLQFII DAFKGQVFAL
1010 1020 1030 1040 1050
STHPYGCRVI QRILEHCLPD QTLPILEELH QHTEQLVQDQ YGNYVIQHVL
1060 1070 1080 1090 1100
EHGRPEDKSK IVAEIRGNVL VLSQHKFASN VVEKCVTHAS RTERAVLIDE
1110 1120 1130 1140 1150
VCTMNDGPHS ALYTMMKDQY ANYVVQKMID VAEPGQRKIV MHKIRPHIAT
1160 1170 1180
LRKYTYGKHI LAKLEKYYMK NGVDLGPICG PPNGII
Length:1,186
Mass (Da):126,473
Last modified:February 2, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE1E0D8B3B0181308
GO
Isoform 2 (identifier: Q14671-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     417-417: I → IA
     597-623: Missing.
     950-950: Q → QVI

Note: No experimental confirmation available.
Show »
Length:1,162
Mass (Da):124,420
Checksum:i84FF134AA644F074
GO
Isoform 3 (identifier: Q14671-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     950-950: Q → QVI

Note: No experimental confirmation available.
Show »
Length:1,188
Mass (Da):126,685
Checksum:i2CA1B7A40A641F4C
GO
Isoform 4 (identifier: Q14671-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPLPPPGPGPEPIPGCTAPTQSPVGRHVVGVKGVGGM
     145-240: Missing.
     417-417: I → IA

Note: No experimental confirmation available.
Show »
Length:1,127
Mass (Da):119,558
Checksum:i296596BFAD017D3F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T1Z8Q5T1Z8_HUMAN
Pumilio homolog 1 (Drosophila), iso...
PUM1 hCG_19946
1,224Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T1Z4Q5T1Z4_HUMAN
Pumilio homolog 1 (Drosophila), iso...
PUM1 hCG_19946
1,189Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEH2H0YEH2_HUMAN
Pumilio homolog 1
PUM1
1,125Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PR38E9PR38_HUMAN
Pumilio homolog 1
PUM1
944Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PL65E9PL65_HUMAN
Pumilio homolog 1
PUM1
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDK8H0YDK8_HUMAN
Pumilio homolog 1
PUM1
900Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YC97H0YC97_HUMAN
Pumilio homolog 1
PUM1
227Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDC5H0YDC5_HUMAN
Pumilio homolog 1
PUM1
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDQ6H0YDQ6_HUMAN
Pumilio homolog 1
PUM1
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMX1E9PMX1_HUMAN
Pumilio homolog 1
PUM1
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA07895 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti216G → E in BAD96325 (Ref. 4) Curated1
Sequence conflicti469Y → N in BAD96325 (Ref. 4) Curated1
Sequence conflicti893M → N in BAA07895 (PubMed:7788527).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0807841033T → S in SCA47; results in reduced PUM1 protein levels and decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1
Natural variantiVAR_0807851137R → W in SCA47; decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1
Natural variantiVAR_0807861145R → W in SCA47; results in reduced PUM1 protein levels and decreased post-transcriptional repression of E2F3 and ATXN1. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0537031M → MPLPPPGPGPEPIPGCTAPT QSPVGRHVVGVKGVGGM in isoform 4. 1 Publication1
Alternative sequenceiVSP_053704145 – 240Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_017059417I → IA in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_017060597 – 623Missing in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_017061950Q → QVI in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF315592 mRNA Translation: AAG31807.1
D43951 mRNA Translation: BAA07895.3 Different initiation.
AL356320, AL445235 Genomic DNA Translation: CAH71203.1
AK291779 mRNA Translation: BAF84468.1
AK294477 mRNA Translation: BAG57703.1
AK222605 mRNA Translation: BAD96325.1
AL445235, AL356320 Genomic DNA Translation: CAI22246.1
CH471059 Genomic DNA Translation: EAX07633.1
CH471059 Genomic DNA Translation: EAX07634.1
BC013398 mRNA Translation: AAH13398.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS338.1 [Q14671-1]
CCDS44099.1 [Q14671-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001018494.1, NM_001020658.1 [Q14671-3]
NP_055491.1, NM_014676.2 [Q14671-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.281707

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000257075; ENSP00000257075; ENSG00000134644 [Q14671-1]
ENST00000373742; ENSP00000362847; ENSG00000134644 [Q14671-4]
ENST00000426105; ENSP00000391723; ENSG00000134644 [Q14671-3]
ENST00000440538; ENSP00000401777; ENSG00000134644 [Q14671-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9698

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9698

UCSC genome browser

More...
UCSCi
uc001bsh.2 human [Q14671-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF315592 mRNA Translation: AAG31807.1
D43951 mRNA Translation: BAA07895.3 Different initiation.
AL356320, AL445235 Genomic DNA Translation: CAH71203.1
AK291779 mRNA Translation: BAF84468.1
AK294477 mRNA Translation: BAG57703.1
AK222605 mRNA Translation: BAD96325.1
AL445235, AL356320 Genomic DNA Translation: CAI22246.1
CH471059 Genomic DNA Translation: EAX07633.1
CH471059 Genomic DNA Translation: EAX07634.1
BC013398 mRNA Translation: AAH13398.1
CCDSiCCDS338.1 [Q14671-1]
CCDS44099.1 [Q14671-3]
RefSeqiNP_001018494.1, NM_001020658.1 [Q14671-3]
NP_055491.1, NM_014676.2 [Q14671-1]
UniGeneiHs.281707

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IB2X-ray1.90A828-1176[»]
1M8WX-ray2.20A/B828-1176[»]
1M8XX-ray2.20A/B828-1176[»]
1M8YX-ray2.60A/B828-1176[»]
1M8ZX-ray1.90A828-1176[»]
2YJYX-ray2.60A/B828-1176[»]
3BSBX-ray2.80A/B828-1170[»]
3BSXX-ray2.32A/B828-1170[»]
3Q0LX-ray2.50A/B828-1176[»]
3Q0MX-ray2.70A/B828-1176[»]
3Q0NX-ray2.40A/B828-1176[»]
3Q0OX-ray2.80A/B828-1176[»]
3Q0PX-ray2.60A/B828-1176[»]
5YKHX-ray2.46A898-1176[»]
5YKIX-ray2.25A898-1176[»]
ProteinModelPortaliQ14671
SMRiQ14671
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115050, 91 interactors
DIPiDIP-29082N
IntActiQ14671, 23 interactors
MINTiQ14671
STRINGi9606.ENSP00000391723

PTM databases

iPTMnetiQ14671
PhosphoSitePlusiQ14671

Polymorphism and mutation databases

BioMutaiPUM1
DMDMi41688619

2D gel databases

UCD-2DPAGEiQ14671

Proteomic databases

EPDiQ14671
MaxQBiQ14671
PaxDbiQ14671
PeptideAtlasiQ14671
PRIDEiQ14671
ProteomicsDBi60101
60102 [Q14671-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9698
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257075; ENSP00000257075; ENSG00000134644 [Q14671-1]
ENST00000373742; ENSP00000362847; ENSG00000134644 [Q14671-4]
ENST00000426105; ENSP00000391723; ENSG00000134644 [Q14671-3]
ENST00000440538; ENSP00000401777; ENSG00000134644 [Q14671-2]
GeneIDi9698
KEGGihsa:9698
UCSCiuc001bsh.2 human [Q14671-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9698
DisGeNETi9698
EuPathDBiHostDB:ENSG00000134644.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PUM1
HGNCiHGNC:14957 PUM1
HPAiHPA027424
HPA027449
MalaCardsiPUM1
MIMi607204 gene
617931 phenotype
neXtProtiNX_Q14671
OpenTargetsiENSG00000134644
PharmGKBiPA34042

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1488 Eukaryota
COG5099 LUCA
GeneTreeiENSGT00940000158079
HOGENOMiHOG000238461
HOVERGENiHBG049462
InParanoidiQ14671
KOiK17943
PhylomeDBiQ14671
TreeFamiTF318160

Enzyme and pathway databases

ReactomeiR-HSA-432722 Golgi Associated Vesicle Biogenesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PUM1 human
EvolutionaryTraceiQ14671

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PUM1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9698

Protein Ontology

More...
PROi
PR:Q14671

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134644 Expressed in 243 organ(s), highest expression level in cerebral cortex
CleanExiHS_PUM1
ExpressionAtlasiQ14671 baseline and differential
GenevisibleiQ14671 HS

Family and domain databases

CDDicd07920 Pumilio, 1 hit
Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR033133 PUM-HD
IPR033712 Pumilio_RNA-bd
IPR001313 Pumilio_RNA-bd_rpt
PfamiView protein in Pfam
PF00806 PUF, 8 hits
SMARTiView protein in SMART
SM00025 Pumilio, 8 hits
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50302 PUM, 8 hits
PS50303 PUM_HD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPUM1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14671
Secondary accession number(s): A8K6W4
, B4DG92, D3DPN3, E9PCJ0, Q53HH5, Q5VXY7, Q9HAN1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: February 2, 2004
Last modified: December 5, 2018
This is version 170 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again