Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 183 (16 Oct 2019)
Sequence version 1 (01 Nov 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

E3 ubiquitin-protein ligase TRIP12

Gene

TRIP12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase involved in ubiquitin fusion degradation (UFD) pathway and regulation of DNA repair (PubMed:19028681, PubMed:22884692). Part of the ubiquitin fusion degradation (UFD) pathway, a process that mediates ubiquitination of protein at their N-terminus, regardless of the presence of lysine residues in target proteins (PubMed:19028681). Acts as a key regulator of DNA damage response by acting as a suppressor of RNF168, an E3 ubiquitin-protein ligase that promotes accumulation of 'Lys-63'-linked histone H2A and H2AX at DNA damage sites, thereby acting as a guard against excessive spreading of ubiquitinated chromatin at damaged chromosomes (PubMed:22884692). In normal cells, mediates ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A, a lysine-less tumor suppressor required for p53/TP53 activation under oncogenic stress (PubMed:20208519). In cancer cells, however, isoform p19ARF/ARF and TRIP12 are located in different cell compartments, preventing isoform p19ARF/ARF ubiquitination and degradation (PubMed:20208519). Does not mediate ubiquitination of isoform p16-INK4a of CDKN2A (PubMed:20208519). Also catalyzes ubiquitination of NAE1 and SMARCE1, leading to their degradation (PubMed:18627766). Ubiquitination and degradation of target proteins is regulated by interaction with proteins such as MYC, TRADD or SMARCC1, which disrupt the interaction between TRIP12 and target proteins (PubMed:20829358). Mediates ubiquitination of ASXL1: following binding to N6-methyladenosine methylated DNA, ASXL1 is ubiquitinated by TRIP12, leading to its degradation and subsequent inactivation of the PR-DUB complex (PubMed:30982744).6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.3 Publications
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1959Glycyl thioester intermediateCurated1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processDNA damage, DNA repair, Ubl conjugation pathway

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.3.2.B9 2681
6.3.2.19 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIP12 (EC:2.3.2.263 Publications)
Alternative name(s):
E3 ubiquitin-protein ligase for Arf
Short name:
ULF
HECT-type E3 ubiquitin transferase TRIP12
Thyroid receptor-interacting protein 12
Short name:
TR-interacting protein 12
Short name:
TRIP-12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRIP12
Synonyms:KIAA0045, ULF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12306 TRIP12

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604506 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14669

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, autosomal dominant 49 (MRD49)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0804315P → L in MRD49; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1300458163Ensembl.1
Natural variantiVAR_080432338 – 1992Missing in MRD49; unknown pathological significance. 1 PublicationAdd BLAST1655
Natural variantiVAR_080433352 – 1992Missing in MRD49; unknown pathological significance. 1 PublicationAdd BLAST1641
Natural variantiVAR_080434761A → V in MRD49. 2 PublicationsCorresponds to variant dbSNP:rs373429636Ensembl.1
Natural variantiVAR_0804351449 – 1992Missing in MRD49. 1 PublicationAdd BLAST544
Natural variantiVAR_0804361557D → H in MRD49. 1 Publication1
Natural variantiVAR_0804371595R → Q in MRD49. 1 PublicationCorresponds to variant dbSNP:rs1553602821Ensembl.1
Natural variantiVAR_0804381840S → L in MRD49. 1 PublicationCorresponds to variant dbSNP:rs866079762Ensembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1959C → A: Abolishes E3 ubiquitin-protein ligase activity. 1 Publication1

Keywords - Diseasei

Autism spectrum disorder, Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
9320

MalaCards human disease database

More...
MalaCardsi
TRIP12
MIMi617752 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000153827

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36985

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14669

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRIP12

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2499839

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001738722 – 1992E3 ubiquitin-protein ligase TRIP12Add BLAST1991

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei77PhosphoserineCombined sources1
Modified residuei85PhosphoserineBy similarity1
Modified residuei100PhosphoserineCombined sources1
Modified residuei181N6-acetyllysineBy similarity1
Modified residuei310PhosphoserineCombined sources1
Modified residuei312PhosphoserineCombined sources1
Modified residuei942PhosphoserineCombined sources1
Modified residuei991PhosphoserineCombined sources1
Modified residuei997PhosphoserineCombined sources1
Modified residuei1016PhosphoserineBy similarity1
Modified residuei1030PhosphoserineCombined sources1
Modified residuei1317PhosphoserineCombined sources1
Modified residuei1322PhosphoserineCombined sources1
Modified residuei1329PhosphoserineBy similarity1
Modified residuei1376PhosphoserineBy similarity1
Modified residuei1377PhosphothreonineBy similarity1
Modified residuei1425N6-acetyllysineBy similarity1
Modified residuei1427PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14669

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14669

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14669

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14669

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14669

PeptideAtlas

More...
PeptideAtlasi
Q14669

PRoteomics IDEntifications database

More...
PRIDEi
Q14669

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60100 [Q14669-1]
60316
60326

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14669

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14669

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q14669

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000153827 Expressed in 238 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14669 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14669 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036835
HPA045893

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYC; leading to disrupt interaction with isoform p19ARF/ARF of CDKN2A (PubMed:20208519).

Interacts with TRADD; leading to disrupt interaction with isoform p19ARF/ARF of CDKN2A (PubMed:22561347).

Interacts with SMARCC1; leading to disrupt interaction with SMARCE1 (PubMed:20829358).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114731, 78 interactors

Database of interacting proteins

More...
DIPi
DIP-58584N

Protein interaction database and analysis system

More...
IntActi
Q14669, 45 interactors

Molecular INTeraction database

More...
MINTi
Q14669

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373696

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini749 – 836WWEPROSITE-ProRule annotationAdd BLAST88
Domaini1885 – 1992HECTPROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1496 – 1570K-boxAdd BLAST75

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UPL family. K-HECT subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0168 Eukaryota
KOG0170 Eukaryota
COG5021 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156517

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007873

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14669

KEGG Orthology (KO)

More...
KOi
K10590

Identification of Orthologs from Complete Genome Data

More...
OMAi
HGFNMDS

Database of Orthologous Groups

More...
OrthoDBi
34110at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14669

TreeFam database of animal gene trees

More...
TreeFami
TF323674

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00078 HECTc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR004170 WWE-dom
IPR037197 WWE_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00632 HECT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00119 HECTc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF117839 SSF117839, 1 hit
SSF48371 SSF48371, 1 hit
SSF56204 SSF56204, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50237 HECT, 1 hit
PS50918 WWE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14669-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSNRPNNNPG GSLRRSQRNT AGAQPQDDSI GGRSCSSSSA VIVPQPEDPD
60 70 80 90 100
RANTSERQKT GQVPKKDNSR GVKRSASPDY NRTNSPSSAK KPKALQHTES
110 120 130 140 150
PSETNKPHSK SKKRHLDQEQ QLKSAQSPST SKAHTRKSGA TGGSRSQKRK
160 170 180 190 200
RTESSCVKSG SGSESTGAEE RSAKPTKLAS KSATSAKAGC STITDSSSAA
210 220 230 240 250
STSSSSSAVA SASSTVPPGA RVKQGKDQNK ARRSRSASSP SPRRSSREKE
260 270 280 290 300
QSKTGGSSKF DWAARFSPKV SLPKTKLSLP GSSKSETSKP GPSGLQAKLA
310 320 330 340 350
SLRKSTKKRS ESPPAELPSL RRSTRQKTTG SCASTSRRGS GLGKRGAAEA
360 370 380 390 400
RRQEKMADPE SNQEAVNSSA ARTDEAPQGA AGAVGMTTSG ESESDDSEMG
410 420 430 440 450
RLQALLEARG LPPHLFGPLG PRMSQLFHRT IGSGASSKAQ QLLQGLQASD
460 470 480 490 500
ESQQLQAVIE MCQLLVMGNE ETLGGFPVKS VVPALITLLQ MEHNFDIMNH
510 520 530 540 550
ACRALTYMME ALPRSSAVVV DAIPVFLEKL QVIQCIDVAE QALTALEMLS
560 570 580 590 600
RRHSKAILQA GGLADCLLYL EFFSINAQRN ALAIAANCCQ SITPDEFHFV
610 620 630 640 650
ADSLPLLTQR LTHQDKKSVE STCLCFARLV DNFQHEENLL QQVASKDLLT
660 670 680 690 700
NVQQLLVVTP PILSSGMFIM VVRMFSLMCS NCPTLAVQLM KQNIAETLHF
710 720 730 740 750
LLCGASNGSC QEQIDLVPRS PQELYELTSL ICELMPCLPK EGIFAVDTML
760 770 780 790 800
KKGNAQNTDG AIWQWRDDRG LWHPYNRIDS RIIEQINEDT GTARAIQRKP
810 820 830 840 850
NPLANSNTSG YSESKKDDAR AQLMKEDPEL AKSFIKTLFG VLYEVYSSSA
860 870 880 890 900
GPAVRHKCLR AILRIIYFAD AELLKDVLKN HAVSSHIASM LSSQDLKIVV
910 920 930 940 950
GALQMAEILM QKLPDIFSVY FRREGVMHQV KHLAESESLL TSPPKACTNG
960 970 980 990 1000
SGSMGSTTSV SSGTATAATH AAADLGSPSL QHSRDDSLDL SPQGRLSDVL
1010 1020 1030 1040 1050
KRKRLPKRGP RRPKYSPPRD DDKVDNQAKS PTTTQSPKSS FLASLNPKTW
1060 1070 1080 1090 1100
GRLSTQSNSN NIEPARTAGG SGLARAASKD TISNNREKIK GWIKEQAHKF
1110 1120 1130 1140 1150
VERYFSSENM DGSNPALNVL QRLCAATEQL NLQVDGGAEC LVEIRSIVSE
1160 1170 1180 1190 1200
SDVSSFEIQH SGFVKQLLLY LTSKSEKDAV SREIRLKRFL HVFFSSPLPG
1210 1220 1230 1240 1250
EEPIGRVEPV GNAPLLALVH KMNNCLSQME QFPVKVHDFP SGNGTGGSFS
1260 1270 1280 1290 1300
LNRGSQALKF FNTHQLKCQL QRHPDCANVK QWKGGPVKID PLALVQAIER
1310 1320 1330 1340 1350
YLVVRGYGRV REDDEDSDDD GSDEEIDESL AAQFLNSGNV RHRLQFYIGE
1360 1370 1380 1390 1400
HLLPYNMTVY QAVRQFSIQA EDERESTDDE SNPLGRAGIW TKTHTIWYKP
1410 1420 1430 1440 1450
VREDEESNKD CVGGKRGRAQ TAPTKTSPRN AKKHDELWHD GVCPSVSNPL
1460 1470 1480 1490 1500
EVYLIPTPPE NITFEDPSLD VILLLRVLHA ISRYWYYLYD NAMCKEIIPT
1510 1520 1530 1540 1550
SEFINSKLTA KANRQLQDPL VIMTGNIPTW LTELGKTCPF FFPFDTRQML
1560 1570 1580 1590 1600
FYVTAFDRDR AMQRLLDTNP EINQSDSQDS RVAPRLDRKK RTVNREELLK
1610 1620 1630 1640 1650
QAESVMQDLG SSRAMLEIQY ENEVGTGLGP TLEFYALVSQ ELQRADLGLW
1660 1670 1680 1690 1700
RGEEVTLSNP KGSQEGTKYI QNLQGLFALP FGRTAKPAHI AKVKMKFRFL
1710 1720 1730 1740 1750
GKLMAKAIMD FRLVDLPLGL PFYKWMLRQE TSLTSHDLFD IDPVVARSVY
1760 1770 1780 1790 1800
HLEDIVRQKK RLEQDKSQTK ESLQYALETL TMNGCSVEDL GLDFTLPGFP
1810 1820 1830 1840 1850
NIELKKGGKD IPVTIHNLEE YLRLVIFWAL NEGVSRQFDS FRDGFESVFP
1860 1870 1880 1890 1900
LSHLQYFYPE ELDQLLCGSK ADTWDAKTLM ECCRPDHGYT HDSRAVKFLF
1910 1920 1930 1940 1950
EILSSFDNEQ QRLFLQFVTG SPRLPVGGFR SLNPPLTIVR KTFESTENPD
1960 1970 1980 1990
DFLPSVMTCV NYLKLPDYSS IEIMREKLLI AAREGQQSFH LS
Length:1,992
Mass (Da):220,434
Last modified:November 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i294A7C063A3332DE
GO
Isoform 2 (identifier: Q14669-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-380: A → AAASSSV
     784-784: E → EAAHQVGEDEISLSTLGRVYTIDFNSMQ

Show »
Length:2,025
Mass (Da):223,900
Checksum:iCCC35A77D4040B85
GO
Isoform 3 (identifier: Q14669-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-32: G → GRSHLGQAKHKGYSPPESRKSNSKAPKVQSNTTSELSRGHLSK
     380-380: A → AAASSSV

Note: No experimental confirmation available.
Show »
Length:2,040
Mass (Da):225,520
Checksum:i8038779A69BBE66B
GO
Isoform 4 (identifier: Q14669-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-335: Missing.
     380-380: A → AAASSSV
     784-784: E → EAAHQVGEDEISLSTLGRVYTIDFNSMQ

Note: No experimental confirmation available.
Show »
Length:1,722
Mass (Da):192,075
Checksum:iDF23E5E19D306C51
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C2Y1H7C2Y1_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLD7C9JLD7_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLJ5C9JLJ5_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSX9C9JSX9_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W9P3F8W9P3_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E9G6G5E9G6_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12 hCG_1811426
430Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1L9H7C1L9_HUMAN
E3 ubiquitin-protein ligase TRIP12
TRIP12
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAY14681 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAY14755 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAA05837 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1969 – 1992SSIEI…SFHLS → QALRYA in AAC41731 (PubMed:7776974).CuratedAdd BLAST24
Isoform 2 (identifier: Q14669-2)
Sequence conflicti380A → T in ACC99349 (PubMed:20208519).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0804315P → L in MRD49; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1300458163Ensembl.1
Natural variantiVAR_080432338 – 1992Missing in MRD49; unknown pathological significance. 1 PublicationAdd BLAST1655
Natural variantiVAR_080433352 – 1992Missing in MRD49; unknown pathological significance. 1 PublicationAdd BLAST1641
Natural variantiVAR_080434761A → V in MRD49. 2 PublicationsCorresponds to variant dbSNP:rs373429636Ensembl.1
Natural variantiVAR_0804351449 – 1992Missing in MRD49. 1 PublicationAdd BLAST544
Natural variantiVAR_0804361557D → H in MRD49. 1 Publication1
Natural variantiVAR_0804371595R → Q in MRD49. 1 PublicationCorresponds to variant dbSNP:rs1553602821Ensembl.1
Natural variantiVAR_0804381840S → L in MRD49. 1 PublicationCorresponds to variant dbSNP:rs866079762Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04432632G → GRSHLGQAKHKGYSPPESRK SNSKAPKVQSNTTSELSRGH LSK in isoform 3. 1 Publication1
Alternative sequenceiVSP_04432733 – 335Missing in isoform 4. 1 PublicationAdd BLAST303
Alternative sequenceiVSP_044328380A → AAASSSV in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_044329784E → EAAHQVGEDEISLSTLGRVY TIDFNSMQ in isoform 2 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EU489742 mRNA Translation: ACC99349.1
D28476 mRNA Translation: BAA05837.2 Different initiation.
AC009973 Genomic DNA Translation: AAY14755.1 Sequence problems.
AC093384 Genomic DNA Translation: AAY14681.1 Sequence problems.
AC105380 Genomic DNA No translation available.
BC114556 mRNA Translation: AAI14557.1
BC113891 mRNA Translation: AAI13892.1
L40383 mRNA Translation: AAC41731.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33391.1 [Q14669-1]
CCDS63145.1 [Q14669-4]
CCDS63146.1 [Q14669-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001271143.1, NM_001284214.1 [Q14669-3]
NP_001271144.1, NM_001284215.2 [Q14669-2]
NP_001271145.1, NM_001284216.1 [Q14669-4]
NP_001335244.1, NM_001348315.1 [Q14669-3]
NP_001335245.1, NM_001348316.1 [Q14669-2]
NP_004229.1, NM_004238.2 [Q14669-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000283943; ENSP00000283943; ENSG00000153827 [Q14669-1]
ENST00000389044; ENSP00000373696; ENSG00000153827 [Q14669-3]
ENST00000389045; ENSP00000373697; ENSG00000153827 [Q14669-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9320

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9320

UCSC genome browser

More...
UCSCi
uc002vpw.3 human [Q14669-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU489742 mRNA Translation: ACC99349.1
D28476 mRNA Translation: BAA05837.2 Different initiation.
AC009973 Genomic DNA Translation: AAY14755.1 Sequence problems.
AC093384 Genomic DNA Translation: AAY14681.1 Sequence problems.
AC105380 Genomic DNA No translation available.
BC114556 mRNA Translation: AAI14557.1
BC113891 mRNA Translation: AAI13892.1
L40383 mRNA Translation: AAC41731.1
CCDSiCCDS33391.1 [Q14669-1]
CCDS63145.1 [Q14669-4]
CCDS63146.1 [Q14669-3]
RefSeqiNP_001271143.1, NM_001284214.1 [Q14669-3]
NP_001271144.1, NM_001284215.2 [Q14669-2]
NP_001271145.1, NM_001284216.1 [Q14669-4]
NP_001335244.1, NM_001348315.1 [Q14669-3]
NP_001335245.1, NM_001348316.1 [Q14669-2]
NP_004229.1, NM_004238.2 [Q14669-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi114731, 78 interactors
DIPiDIP-58584N
IntActiQ14669, 45 interactors
MINTiQ14669
STRINGi9606.ENSP00000373696

PTM databases

iPTMnetiQ14669
PhosphoSitePlusiQ14669
SwissPalmiQ14669

Polymorphism and mutation databases

BioMutaiTRIP12
DMDMi2499839

Proteomic databases

EPDiQ14669
jPOSTiQ14669
MassIVEiQ14669
MaxQBiQ14669
PaxDbiQ14669
PeptideAtlasiQ14669
PRIDEiQ14669
ProteomicsDBi60100 [Q14669-1]
60316
60326

Genome annotation databases

EnsembliENST00000283943; ENSP00000283943; ENSG00000153827 [Q14669-1]
ENST00000389044; ENSP00000373696; ENSG00000153827 [Q14669-3]
ENST00000389045; ENSP00000373697; ENSG00000153827 [Q14669-4]
GeneIDi9320
KEGGihsa:9320
UCSCiuc002vpw.3 human [Q14669-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9320
DisGeNETi9320

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRIP12
HGNCiHGNC:12306 TRIP12
HPAiHPA036835
HPA045893
MalaCardsiTRIP12
MIMi604506 gene
617752 phenotype
neXtProtiNX_Q14669
OpenTargetsiENSG00000153827
PharmGKBiPA36985

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0168 Eukaryota
KOG0170 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00940000156517
HOGENOMiHOG000007873
InParanoidiQ14669
KOiK10590
OMAiHGFNMDS
OrthoDBi34110at2759
PhylomeDBiQ14669
TreeFamiTF323674

Enzyme and pathway databases

UniPathwayiUPA00143
BRENDAi2.3.2.B9 2681
6.3.2.19 2681
ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TRIP12 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TRIP12

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9320
PharosiQ14669

Protein Ontology

More...
PROi
PR:Q14669

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000153827 Expressed in 238 organ(s), highest expression level in testis
ExpressionAtlasiQ14669 baseline and differential
GenevisibleiQ14669 HS

Family and domain databases

CDDicd00078 HECTc, 1 hit
Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000569 HECT_dom
IPR035983 Hect_E3_ubiquitin_ligase
IPR004170 WWE-dom
IPR037197 WWE_dom_sf
PfamiView protein in Pfam
PF00632 HECT, 1 hit
SMARTiView protein in SMART
SM00119 HECTc, 1 hit
SUPFAMiSSF117839 SSF117839, 1 hit
SSF48371 SSF48371, 1 hit
SSF56204 SSF56204, 1 hit
PROSITEiView protein in PROSITE
PS50237 HECT, 1 hit
PS50918 WWE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRIPC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14669
Secondary accession number(s): D4HL82
, Q14CA3, Q14CF1, Q15644, Q53R87, Q53TE7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: October 16, 2019
This is version 183 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again