Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 268

Gene

ZNF268

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1: Acts as a transcriptional repressor. Inhibits erythroid differentiation and tumor cell proliferation. Plays a role during ovarian cancer development and progression.
Isoform 2: Contributes to cervical carcinogenesis in part through the TNF-alpha-induced NF-kappa-B signaling pathway by interacting with the I-kappa-B-kinase (IKK) core complex.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri276 – 298C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri416 – 438C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri444 – 466C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri472 – 494C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri500 – 522C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri528 – 550C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri556 – 578C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri584 – 606C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri612 – 634C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri668 – 690C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri696 – 718C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri724 – 746C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri752 – 774C2H2-type 18PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri780 – 802C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri808 – 830C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri836 – 858C2H2-type 21PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri864 – 886C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri892 – 914C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri920 – 942C2H2-type 24PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processDifferentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ14587

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 268
Alternative name(s):
Zinc finger protein HZF3
Gene namesi
Name:ZNF268
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000090612.20
HGNCiHGNC:13061 ZNF268
MIMi604753 gene
neXtProtiNX_Q14587

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi85D → A: Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-86. 1 Publication1
Mutagenesisi86V → A: Reduces nuclear localization. Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-85. 1 Publication1
Mutagenesisi88V → A: Reduces nuclear localization. 1 Publication1
Mutagenesisi90F → A: Reduces nuclear localization. 1 Publication1
Mutagenesisi93E → A: Reduces nuclear localization. Strongly reduces nuclear localization; when associated with A-94 and A-95. 1 Publication1
Mutagenesisi94E → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-95. 1 Publication1
Mutagenesisi95W → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-94. 1 Publication1

Organism-specific databases

DisGeNETi10795
OpenTargetsiENSG00000090612
PharmGKBiPA37639

Polymorphism and mutation databases

BioMutaiZNF268
DMDMi19863363

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000474951 – 947Zinc finger protein 268Add BLAST947

Proteomic databases

EPDiQ14587
MaxQBiQ14587
PaxDbiQ14587
PeptideAtlasiQ14587
PRIDEiQ14587
ProteomicsDBi60060
60061 [Q14587-2]

PTM databases

iPTMnetiQ14587
PhosphoSitePlusiQ14587

Expressioni

Tissue specificityi

Overexpressed in ovarian cancer tissues compared to normal ovarian tissues. Isoform 1 and isoform 2 are expressed in squamous epithelium tissues. Isoform 2 is overexpressed in squamous cervical cancer (at protein level). Expressed in blood cells. Isoform 1 is expressed in pancreas, lung, skeletal muscle, heart, placenta, liver, kidney and brain. Isoform 2 expressed in chronic lymphocytic leukemia (CLL) and several tumor cell lines. Isoform 3 is expressed in several tumor cells. Isoform 5 is expressed in fetal liver and several tumor cells. Isoform 6 is weakly expressed in brain, lung amd small intestin and in several tumor cells. Isoform 7 is expressed in fetal liver and several tumor cells.6 Publications

Developmental stagei

Expressed in fetal liver from 5 weeks until 4 months but drastically reduced by 6 months and became non-detectible by 7 months. Expressed in hematopoietic stem cells in 3 weeks and 5 weeks (at protein level). Expressed in fetal liver.2 Publications

Inductioni

Down-regulated during erythroid differentiation by GATA1. Down-regulated by HTLV-1 Tax through the CREB/ATF pathway. Up-regulated by the regulator of nonsense transcript UPF1. Up-regulated by the cyclic AMP-dependent transcription factor ATF4.4 Publications

Gene expression databases

BgeeiENSG00000090612 Expressed in 216 organ(s), highest expression level in intestine
CleanExiHS_ZNF268
ExpressionAtlasiQ14587 baseline and differential
GenevisibleiQ14587 HS

Organism-specific databases

HPAiHPA001794

Interactioni

Subunit structurei

Interacts (via the KRAB domain) with TRIM28 (via the RBCC domain); the interaction increases ZNF268 nuclear localization activity. Isoform 2 interacts with CHUK and IKBKB; the interaction is further increased in a TNF-alpha-dependent manner.2 Publications

Protein-protein interaction databases

BioGridi116010, 6 interactors
IntActiQ14587, 1 interactor
STRINGi9606.ENSP00000228289

Structurei

Secondary structure

1947
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ14587
SMRiQ14587
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14587

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini81 – 152KRABPROSITE-ProRule annotationAdd BLAST72

Domaini

The KRAB domain functions to reinforce the nuclear localization of isoform 1 in addition to its transcription repression activity.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri276 – 298C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri416 – 438C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri444 – 466C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri472 – 494C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri500 – 522C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri528 – 550C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri556 – 578C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri584 – 606C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri612 – 634C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri668 – 690C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri696 – 718C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri724 – 746C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri752 – 774C2H2-type 18PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri780 – 802C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri808 – 830C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri836 – 858C2H2-type 21PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri864 – 886C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri892 – 914C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri920 – 942C2H2-type 24PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00930000150832
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ14587
KOiK09228
OMAiMKPYVCN
OrthoDBiEOG091G02KC
PhylomeDBiQ14587

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 21 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 24 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 12 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 24 hits
PS50157 ZINC_FINGER_C2H2_2, 24 hits

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14587-1) [UniParc]FASTAAdd to basket
Also known as: ZNF268a, KW-4 variant-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATRVRTASI WVPPLQERNS SWDRIRKLQG QESILGQGTP GLQPLPGTPR
60 70 80 90 100
QKQKSRRIEK VLEWLFISQE QPKITKSWGP LSFMDVFVDF TWEEWQLLDP
110 120 130 140 150
AQKCLYRSVM LENYSNLVSL GYQHTKPDII FKLEQGEELC MVQAQVPNQT
160 170 180 190 200
CPNTVWKIDD LMDWHQENKD KLGSTAKSFE CTTFGKLCLL STKYLSRQKP
210 220 230 240 250
HKCGTHGKSL KYIDFTSDYA RNNPNGFQVH GKSFFHSKHE QTVIGIKYCE
260 270 280 290 300
SIESGKTVNK KSQLMCQQMY MGEKPFGCSC CEKAFSSKSY LLVHQQTHAE
310 320 330 340 350
EKPYGCNECG KDFSSKSYLI VHQRIHTGEK LHECSECRKT FSFHSQLVIH
360 370 380 390 400
QRIHTGENPY ECCECGKVFS RKDQLVSHQK THSGQKPYVC NECGKAFGLK
410 420 430 440 450
SQLIIHERIH TGEKPYECNE CQKAFNTKSN LMVHQRTHTG EKPYVCSDCG
460 470 480 490 500
KAFTFKSQLI VHQGIHTGVK PYGCIQCGKG FSLKSQLIVH QRSHTGMKPY
510 520 530 540 550
VCNECGKAFR SKSYLIIHTR THTGEKLHEC NNCGKAFSFK SQLIIHQRIH
560 570 580 590 600
TGENPYECHE CGKAFSRKYQ LISHQRTHAG EKPYECTDCG KAFGLKSQLI
610 620 630 640 650
IHQRTHTGEK PFECSECQKA FNTKSNLIVH QRTHTGEKPY SCNECGKAFT
660 670 680 690 700
FKSQLIVHKG VHTGVKPYGC SQCAKTFSLK SQLIVHQRSH TGVKPYGCSE
710 720 730 740 750
CGKAFRSKSY LIIHMRTHTG EKPHECRECG KSFSFNSQLI VHQRIHTGEN
760 770 780 790 800
PYECSECGKA FNRKDQLISH QRTHAGEKPY GCSECGKAFS SKSYLIIHMR
810 820 830 840 850
THSGEKPYEC NECGKAFIWK SLLIVHERTH AGVNPYKCSQ CEKSFSGKLR
860 870 880 890 900
LLVHQRMHTR EKPYECSECG KAFIRNSQLI VHQRTHSGEK PYGCNECGKT
910 920 930 940
FSQKSILSAH QRTHTGEKPC KCTECGKAFC WKSQLIMHQR THVDDKH
Length:947
Mass (Da):108,374
Last modified:August 29, 2001 - v2
Checksum:iAC78F4824F4BE1A0
GO
Isoform 2 (identifier: Q14587-2) [UniParc]FASTAAdd to basket
Also known as: ZNF268s, KW-4 variant-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-161: Missing.

Show »
Length:786
Mass (Da):89,632
Checksum:i95F58663B2FEE18E
GO
Isoform 3 (identifier: Q14587-3) [UniParc]FASTAAdd to basket
Also known as: ZNF268c

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.
     222-947: Missing.

Show »
Length:81
Mass (Da):9,314
Checksum:iA48BA28E62F0BD17
GO
Isoform 4 (identifier: Q14587-4) [UniParc]FASTAAdd to basket
Also known as: ZNF268d

The sequence of this isoform differs from the canonical sequence as follows:
     12-99: VPPLQERNSS...FTWEEWQLLD → GTNTPNLISS...LINVARMERV
     100-947: Missing.

Show »
Length:100
Mass (Da):11,720
Checksum:i74B1E1A3DE23D260
GO
Isoform 5 (identifier: Q14587-6) [UniParc]FASTAAdd to basket
Also known as: ZNF268e

The sequence of this isoform differs from the canonical sequence as follows:
     79-135: GPLSFMDVFV...KPDIIFKLEQ → TQSGKLMILW...LINVARMERV
     136-947: Missing.

Show »
Length:135
Mass (Da):15,803
Checksum:iA3BD7C64C37509C4
GO
Isoform 6 (identifier: Q14587-7) [UniParc]FASTAAdd to basket
Also known as: ZNF268f

The sequence of this isoform differs from the canonical sequence as follows:
     12-44: VPPLQERNSSWDRIRKLQGQESILGQGTPGLQP → GTNTPNLISSSSWNKEKSCVWCRPKFQIRPVQF
     45-947: Missing.

Show »
Length:44
Mass (Da):5,113
Checksum:i7B18E69B3EBB9DC7
GO
Isoform 7 (identifier: Q14587-8) [UniParc]FASTAAdd to basket
Also known as: ZNF268g

The sequence of this isoform differs from the canonical sequence as follows:
     12-78: Missing.
     153-183: NTVWKIDDLMDWHQENKDKLGSTAKSFECTT → ILKAGKSKAKVLAGLVSGEGPLCASKMTPCC
     184-947: Missing.

Show »
Length:116
Mass (Da):12,931
Checksum:i107B06FCECC69F64
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A075B6T9A0A075B6T9_HUMAN
Zinc finger protein 268
ZNF268
193Annotation score:
K7EQP6K7EQP6_HUMAN
Zinc finger protein 268
ZNF268
126Annotation score:
E7EV44E7EV44_HUMAN
Zinc finger protein 268
ZNF268
188Annotation score:
F5H848F5H848_HUMAN
Zinc finger protein 268
ZNF268
178Annotation score:
A0A087WV54A0A087WV54_HUMAN
Zinc finger protein 268
ZNF268
121Annotation score:
F5H467F5H467_HUMAN
Zinc finger protein 268
ZNF268
35Annotation score:
K7EIF0K7EIF0_HUMAN
Zinc finger protein 268
ZNF268
111Annotation score:
K7EMS6K7EMS6_HUMAN
Zinc finger protein 268
ZNF268
94Annotation score:
F5H7L3F5H7L3_HUMAN
Zinc finger protein 268
ZNF268
167Annotation score:
F5H670F5H670_HUMAN
Zinc finger protein 268
ZNF268
100Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti323Q → P in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti335 – 336SE → IN in AAL99923 (PubMed:12200376).Curated2
Sequence conflicti340T → A in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti344H → Q in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti363C → D in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti409I → T in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti860R → T in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti860R → T in CAA55526 (PubMed:7865130).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033562175T → M. Corresponds to variant dbSNP:rs7975069Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0069091 – 161Missing in isoform 2. 2 PublicationsAdd BLAST161
Alternative sequenceiVSP_0534611 – 140Missing in isoform 3. 2 PublicationsAdd BLAST140
Alternative sequenceiVSP_05346212 – 99VPPLQ…WQLLD → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQTQSGKLMI LWIGIRKIKTSWEVWQKALN ALHLENYVFLVQSIFQDKNL INVARMERV in isoform 4. 2 PublicationsAdd BLAST88
Alternative sequenceiVSP_05346312 – 78Missing in isoform 7. 2 PublicationsAdd BLAST67
Alternative sequenceiVSP_05346412 – 44VPPLQ…PGLQP → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQF in isoform 6. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_05346545 – 947Missing in isoform 6. 2 PublicationsAdd BLAST903
Alternative sequenceiVSP_05346679 – 135GPLSF…FKLEQ → TQSGKLMILWIGIRKIKTSW EVRQKALNALHLENYVFLVQ SIFQDKNLINVARMERV in isoform 5. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_053467100 – 947Missing in isoform 4. 2 PublicationsAdd BLAST848
Alternative sequenceiVSP_053468136 – 947Missing in isoform 5. 2 PublicationsAdd BLAST812
Alternative sequenceiVSP_053469153 – 183NTVWK…FECTT → ILKAGKSKAKVLAGLVSGEG PLCASKMTPCC in isoform 7. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_053470184 – 947Missing in isoform 7. 2 PublicationsAdd BLAST764
Alternative sequenceiVSP_053471222 – 947Missing in isoform 3. 2 PublicationsAdd BLAST726

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF317549 mRNA Translation: AAG59817.1
AF385187 mRNA Translation: AAK69307.1
AF432217 mRNA Translation: AAL99923.1
AC026785 Genomic DNA No translation available.
DQ057356 mRNA No translation available.
DQ057357 mRNA No translation available.
DQ057358 mRNA No translation available.
DQ057359 mRNA No translation available.
DQ057360 mRNA No translation available.
X78926 mRNA Translation: CAA55526.1
CCDSiCCDS45012.1 [Q14587-1]
CCDS53853.1 [Q14587-4]
CCDS59240.1 [Q14587-6]
PIRiS47071
RefSeqiNP_001159353.1, NM_001165881.2 [Q14587-1]
NP_001159355.1, NM_001165883.1 [Q14587-6]
NP_001159356.2, NM_001165884.2
NP_001159357.1, NM_001165885.1
NP_001159358.1, NM_001165886.1
NP_001159359.1, NM_001165887.1
NP_003406.1, NM_003415.2 [Q14587-1]
NP_694422.2, NM_152943.2
UniGeneiHs.124047

Genome annotation databases

EnsembliENST00000228289; ENSP00000228289; ENSG00000090612 [Q14587-1]
ENST00000536435; ENSP00000444412; ENSG00000090612 [Q14587-1]
ENST00000539248; ENSP00000467781; ENSG00000090612 [Q14587-6]
ENST00000588312; ENSP00000466622; ENSG00000090612 [Q14587-7]
GeneIDi10795
KEGGihsa:10795
UCSCiuc010tbw.3 human [Q14587-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF317549 mRNA Translation: AAG59817.1
AF385187 mRNA Translation: AAK69307.1
AF432217 mRNA Translation: AAL99923.1
AC026785 Genomic DNA No translation available.
DQ057356 mRNA No translation available.
DQ057357 mRNA No translation available.
DQ057358 mRNA No translation available.
DQ057359 mRNA No translation available.
DQ057360 mRNA No translation available.
X78926 mRNA Translation: CAA55526.1
CCDSiCCDS45012.1 [Q14587-1]
CCDS53853.1 [Q14587-4]
CCDS59240.1 [Q14587-6]
PIRiS47071
RefSeqiNP_001159353.1, NM_001165881.2 [Q14587-1]
NP_001159355.1, NM_001165883.1 [Q14587-6]
NP_001159356.2, NM_001165884.2
NP_001159357.1, NM_001165885.1
NP_001159358.1, NM_001165886.1
NP_001159359.1, NM_001165887.1
NP_003406.1, NM_003415.2 [Q14587-1]
NP_694422.2, NM_152943.2
UniGeneiHs.124047

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EL4NMR-A663-695[»]
2EL5NMR-A749-777[»]
2EL6NMR-A831-863[»]
2EM1NMR-A637-667[»]
2EMVNMR-A859-889[»]
2EMWNMR-A301-331[»]
2EMXNMR-A273-303[»]
2EMYNMR-A551-583[»]
2EN0NMR-A385-413[»]
2EN6NMR-A887-919[»]
2EN7NMR-A495-525[»]
2EOFNMR-A411-441[»]
2EOGNMR-A693-723[»]
2EOINMR-A329-359[»]
2EOJNMR-A355-385[»]
2EOKNMR-A441-469[»]
2EOLNMR-A581-609[»]
2EOPNMR-A719-751[»]
2EPVNMR-A803-833[»]
2EPWNMR-A915-947[»]
2EPYNMR-A525-553[»]
2YTFNMR-A607-639[»]
2YTQNMR-A775-807[»]
ProteinModelPortaliQ14587
SMRiQ14587
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116010, 6 interactors
IntActiQ14587, 1 interactor
STRINGi9606.ENSP00000228289

PTM databases

iPTMnetiQ14587
PhosphoSitePlusiQ14587

Polymorphism and mutation databases

BioMutaiZNF268
DMDMi19863363

Proteomic databases

EPDiQ14587
MaxQBiQ14587
PaxDbiQ14587
PeptideAtlasiQ14587
PRIDEiQ14587
ProteomicsDBi60060
60061 [Q14587-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000228289; ENSP00000228289; ENSG00000090612 [Q14587-1]
ENST00000536435; ENSP00000444412; ENSG00000090612 [Q14587-1]
ENST00000539248; ENSP00000467781; ENSG00000090612 [Q14587-6]
ENST00000588312; ENSP00000466622; ENSG00000090612 [Q14587-7]
GeneIDi10795
KEGGihsa:10795
UCSCiuc010tbw.3 human [Q14587-1]

Organism-specific databases

CTDi10795
DisGeNETi10795
EuPathDBiHostDB:ENSG00000090612.20
GeneCardsiZNF268
HGNCiHGNC:13061 ZNF268
HPAiHPA001794
MIMi604753 gene
neXtProtiNX_Q14587
OpenTargetsiENSG00000090612
PharmGKBiPA37639
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00930000150832
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ14587
KOiK09228
OMAiMKPYVCN
OrthoDBiEOG091G02KC
PhylomeDBiQ14587

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ14587

Miscellaneous databases

ChiTaRSiZNF268 human
EvolutionaryTraceiQ14587
GeneWikiiZNF268
GenomeRNAii10795
PROiPR:Q14587
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000090612 Expressed in 216 organ(s), highest expression level in intestine
CleanExiHS_ZNF268
ExpressionAtlasiQ14587 baseline and differential
GenevisibleiQ14587 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 21 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 24 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 12 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 24 hits
PS50157 ZINC_FINGER_C2H2_2, 24 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZN268_HUMAN
AccessioniPrimary (citable) accession number: Q14587
Secondary accession number(s): Q8TDG8, Q96RH4, Q9BZJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 29, 2001
Last modified: November 7, 2018
This is version 184 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again