Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 197 (17 Jun 2020)
Sequence version 2 (29 Aug 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 268

Gene

ZNF268

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a transcriptional repressor. Inhibits erythroid differentiation and tumor cell proliferation. Plays a role during ovarian cancer development and progression.
Contributes to cervical carcinogenesis in part through the TNF-alpha-induced NF-kappa-B signaling pathway by interacting with the I-kappa-B-kinase (IKK) core complex.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri276 – 298C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri416 – 438C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri444 – 466C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri472 – 494C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri500 – 522C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri528 – 550C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri556 – 578C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri584 – 606C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri612 – 634C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri668 – 690C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri696 – 718C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri724 – 746C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri752 – 774C2H2-type 18PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri780 – 802C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri808 – 830C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri836 – 858C2H2-type 21PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri864 – 886C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri892 – 914C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri920 – 942C2H2-type 24PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processDifferentiation, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q14587

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 268
Alternative name(s):
Zinc finger protein HZF3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF268
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000090612.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13061 ZNF268

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604753 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14587

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi85D → A: Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-86. 1 Publication1
Mutagenesisi86V → A: Reduces nuclear localization. Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-85. 1 Publication1
Mutagenesisi88V → A: Reduces nuclear localization. 1 Publication1
Mutagenesisi90F → A: Reduces nuclear localization. 1 Publication1
Mutagenesisi93E → A: Reduces nuclear localization. Strongly reduces nuclear localization; when associated with A-94 and A-95. 1 Publication1
Mutagenesisi94E → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-95. 1 Publication1
Mutagenesisi95W → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-94. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10795

Open Targets

More...
OpenTargetsi
ENSG00000090612

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37639

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14587 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF268

Domain mapping of disease mutations (DMDM)

More...
DMDMi
19863363

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000474951 – 947Zinc finger protein 268Add BLAST947

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14587

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14587

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14587

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14587

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14587

PeptideAtlas

More...
PeptideAtlasi
Q14587

PRoteomics IDEntifications database

More...
PRIDEi
Q14587

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
60060 [Q14587-1]
60061 [Q14587-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14587

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14587

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Overexpressed in ovarian cancer tissues compared to normal ovarian tissues. Isoform 1 and isoform 2 are expressed in squamous epithelium tissues. Isoform 2 is overexpressed in squamous cervical cancer (at protein level). Expressed in blood cells. Isoform 1 is expressed in pancreas, lung, skeletal muscle, heart, placenta, liver, kidney and brain. Isoform 2 expressed in chronic lymphocytic leukemia (CLL) and several tumor cell lines. Isoform 3 is expressed in several tumor cells. Isoform 5 is expressed in fetal liver and several tumor cells. Isoform 6 is weakly expressed in brain, lung amd small intestin and in several tumor cells. Isoform 7 is expressed in fetal liver and several tumor cells.6 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal liver from 5 weeks until 4 months but drastically reduced by 6 months and became non-detectable by 7 months. Expressed in hematopoietic stem cells in 3 weeks and 5 weeks (at protein level). Expressed in fetal liver.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated during erythroid differentiation by GATA1. Down-regulated by HTLV-1 Tax through the CREB/ATF pathway. Up-regulated by the regulator of nonsense transcript UPF1. Up-regulated by the cyclic AMP-dependent transcription factor ATF4.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000090612 Expressed in intestine and 215 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14587 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14587 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000090612 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via the KRAB domain) with TRIM28 (via the RBCC domain); the interaction increases ZNF268 nuclear localization activity.

Isoform 2 interacts with CHUK and IKBKB; the interaction is further increased in a TNF-alpha-dependent manner.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116010, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q14587, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000444412

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q14587 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1947
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14587

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14587

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 152KRABPROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KRAB domain functions to reinforce the nuclear localization of isoform 1 in addition to its transcription repression activity.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri276 – 298C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri416 – 438C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri444 – 466C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri472 – 494C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri500 – 522C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri528 – 550C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri556 – 578C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri584 – 606C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri612 – 634C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri668 – 690C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri696 – 718C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri724 – 746C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri752 – 774C2H2-type 18PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri780 – 802C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri808 – 830C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri836 – 858C2H2-type 21PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri864 – 886C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri892 – 914C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri920 – 942C2H2-type 24PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163459

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002678_17_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14587

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
AKGYECT

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14587

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 20 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 24 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 12 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 24 hits
PS50157 ZINC_FINGER_C2H2_2, 24 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14587-1) [UniParc]FASTAAdd to basket
Also known as: ZNF268a, KW-4 variant-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATRVRTASI WVPPLQERNS SWDRIRKLQG QESILGQGTP GLQPLPGTPR
60 70 80 90 100
QKQKSRRIEK VLEWLFISQE QPKITKSWGP LSFMDVFVDF TWEEWQLLDP
110 120 130 140 150
AQKCLYRSVM LENYSNLVSL GYQHTKPDII FKLEQGEELC MVQAQVPNQT
160 170 180 190 200
CPNTVWKIDD LMDWHQENKD KLGSTAKSFE CTTFGKLCLL STKYLSRQKP
210 220 230 240 250
HKCGTHGKSL KYIDFTSDYA RNNPNGFQVH GKSFFHSKHE QTVIGIKYCE
260 270 280 290 300
SIESGKTVNK KSQLMCQQMY MGEKPFGCSC CEKAFSSKSY LLVHQQTHAE
310 320 330 340 350
EKPYGCNECG KDFSSKSYLI VHQRIHTGEK LHECSECRKT FSFHSQLVIH
360 370 380 390 400
QRIHTGENPY ECCECGKVFS RKDQLVSHQK THSGQKPYVC NECGKAFGLK
410 420 430 440 450
SQLIIHERIH TGEKPYECNE CQKAFNTKSN LMVHQRTHTG EKPYVCSDCG
460 470 480 490 500
KAFTFKSQLI VHQGIHTGVK PYGCIQCGKG FSLKSQLIVH QRSHTGMKPY
510 520 530 540 550
VCNECGKAFR SKSYLIIHTR THTGEKLHEC NNCGKAFSFK SQLIIHQRIH
560 570 580 590 600
TGENPYECHE CGKAFSRKYQ LISHQRTHAG EKPYECTDCG KAFGLKSQLI
610 620 630 640 650
IHQRTHTGEK PFECSECQKA FNTKSNLIVH QRTHTGEKPY SCNECGKAFT
660 670 680 690 700
FKSQLIVHKG VHTGVKPYGC SQCAKTFSLK SQLIVHQRSH TGVKPYGCSE
710 720 730 740 750
CGKAFRSKSY LIIHMRTHTG EKPHECRECG KSFSFNSQLI VHQRIHTGEN
760 770 780 790 800
PYECSECGKA FNRKDQLISH QRTHAGEKPY GCSECGKAFS SKSYLIIHMR
810 820 830 840 850
THSGEKPYEC NECGKAFIWK SLLIVHERTH AGVNPYKCSQ CEKSFSGKLR
860 870 880 890 900
LLVHQRMHTR EKPYECSECG KAFIRNSQLI VHQRTHSGEK PYGCNECGKT
910 920 930 940
FSQKSILSAH QRTHTGEKPC KCTECGKAFC WKSQLIMHQR THVDDKH
Length:947
Mass (Da):108,374
Last modified:August 29, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAC78F4824F4BE1A0
GO
Isoform 2 (identifier: Q14587-2) [UniParc]FASTAAdd to basket
Also known as: ZNF268s, KW-4 variant-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-161: Missing.

Show »
Length:786
Mass (Da):89,632
Checksum:i95F58663B2FEE18E
GO
Isoform 3 (identifier: Q14587-3) [UniParc]FASTAAdd to basket
Also known as: ZNF268c

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.
     222-947: Missing.

Show »
Length:81
Mass (Da):9,314
Checksum:iA48BA28E62F0BD17
GO
Isoform 4 (identifier: Q14587-4) [UniParc]FASTAAdd to basket
Also known as: ZNF268d

The sequence of this isoform differs from the canonical sequence as follows:
     12-99: VPPLQERNSS...FTWEEWQLLD → GTNTPNLISS...LINVARMERV
     100-947: Missing.

Show »
Length:100
Mass (Da):11,720
Checksum:i74B1E1A3DE23D260
GO
Isoform 5 (identifier: Q14587-6) [UniParc]FASTAAdd to basket
Also known as: ZNF268e

The sequence of this isoform differs from the canonical sequence as follows:
     79-135: GPLSFMDVFV...KPDIIFKLEQ → TQSGKLMILW...LINVARMERV
     136-947: Missing.

Show »
Length:135
Mass (Da):15,803
Checksum:iA3BD7C64C37509C4
GO
Isoform 6 (identifier: Q14587-7) [UniParc]FASTAAdd to basket
Also known as: ZNF268f

The sequence of this isoform differs from the canonical sequence as follows:
     12-44: VPPLQERNSSWDRIRKLQGQESILGQGTPGLQP → GTNTPNLISSSSWNKEKSCVWCRPKFQIRPVQF
     45-947: Missing.

Show »
Length:44
Mass (Da):5,113
Checksum:i7B18E69B3EBB9DC7
GO
Isoform 7 (identifier: Q14587-8) [UniParc]FASTAAdd to basket
Also known as: ZNF268g

The sequence of this isoform differs from the canonical sequence as follows:
     12-78: Missing.
     153-183: NTVWKIDDLMDWHQENKDKLGSTAKSFECTT → ILKAGKSKAKVLAGLVSGEGPLCASKMTPCC
     184-947: Missing.

Show »
Length:116
Mass (Da):12,931
Checksum:i107B06FCECC69F64
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A075B6T9A0A075B6T9_HUMAN
Zinc finger protein 268
ZNF268
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EV44E7EV44_HUMAN
Zinc finger protein 268
ZNF268
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQP6K7EQP6_HUMAN
Zinc finger protein 268
ZNF268
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H848F5H848_HUMAN
Zinc finger protein 268
ZNF268
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIF0K7EIF0_HUMAN
Zinc finger protein 268
ZNF268
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H467F5H467_HUMAN
Zinc finger protein 268
ZNF268
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMS6K7EMS6_HUMAN
Zinc finger protein 268
ZNF268
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WV54A0A087WV54_HUMAN
Zinc finger protein 268
ZNF268
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H670F5H670_HUMAN
Zinc finger protein 268
ZNF268
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7L3F5H7L3_HUMAN
Zinc finger protein 268
ZNF268
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti323Q → P in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti335 – 336SE → IN in AAL99923 (PubMed:12200376).Curated2
Sequence conflicti340T → A in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti344H → Q in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti363C → D in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti409I → T in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti860R → T in AAL99923 (PubMed:12200376).Curated1
Sequence conflicti860R → T in CAA55526 (PubMed:7865130).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033562175T → M. Corresponds to variant dbSNP:rs7975069Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0069091 – 161Missing in isoform 2. 2 PublicationsAdd BLAST161
Alternative sequenceiVSP_0534611 – 140Missing in isoform 3. 2 PublicationsAdd BLAST140
Alternative sequenceiVSP_05346212 – 99VPPLQ…WQLLD → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQTQSGKLMI LWIGIRKIKTSWEVWQKALN ALHLENYVFLVQSIFQDKNL INVARMERV in isoform 4. 2 PublicationsAdd BLAST88
Alternative sequenceiVSP_05346312 – 78Missing in isoform 7. 2 PublicationsAdd BLAST67
Alternative sequenceiVSP_05346412 – 44VPPLQ…PGLQP → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQF in isoform 6. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_05346545 – 947Missing in isoform 6. 2 PublicationsAdd BLAST903
Alternative sequenceiVSP_05346679 – 135GPLSF…FKLEQ → TQSGKLMILWIGIRKIKTSW EVRQKALNALHLENYVFLVQ SIFQDKNLINVARMERV in isoform 5. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_053467100 – 947Missing in isoform 4. 2 PublicationsAdd BLAST848
Alternative sequenceiVSP_053468136 – 947Missing in isoform 5. 2 PublicationsAdd BLAST812
Alternative sequenceiVSP_053469153 – 183NTVWK…FECTT → ILKAGKSKAKVLAGLVSGEG PLCASKMTPCC in isoform 7. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_053470184 – 947Missing in isoform 7. 2 PublicationsAdd BLAST764
Alternative sequenceiVSP_053471222 – 947Missing in isoform 3. 2 PublicationsAdd BLAST726

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF317549 mRNA Translation: AAG59817.1
AF385187 mRNA Translation: AAK69307.1
AF432217 mRNA Translation: AAL99923.1
AC026785 Genomic DNA No translation available.
DQ057356 mRNA No translation available.
DQ057357 mRNA No translation available.
DQ057358 mRNA No translation available.
DQ057359 mRNA No translation available.
DQ057360 mRNA No translation available.
X78926 mRNA Translation: CAA55526.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45012.1 [Q14587-1]
CCDS53853.1 [Q14587-4]
CCDS59240.1 [Q14587-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
S47071

NCBI Reference Sequences

More...
RefSeqi
NP_001159353.1, NM_001165881.2 [Q14587-1]
NP_001159355.1, NM_001165883.1 [Q14587-6]
NP_001159356.2, NM_001165884.2
NP_001159357.1, NM_001165885.1
NP_001159358.1, NM_001165886.1
NP_001159359.1, NM_001165887.1
NP_003406.1, NM_003415.2 [Q14587-1]
NP_694422.2, NM_152943.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000228289; ENSP00000228289; ENSG00000090612 [Q14587-1]
ENST00000536435; ENSP00000444412; ENSG00000090612 [Q14587-1]
ENST00000539248; ENSP00000467781; ENSG00000090612 [Q14587-6]
ENST00000588312; ENSP00000466622; ENSG00000090612 [Q14587-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10795

UCSC genome browser

More...
UCSCi
uc010tbw.3 human [Q14587-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF317549 mRNA Translation: AAG59817.1
AF385187 mRNA Translation: AAK69307.1
AF432217 mRNA Translation: AAL99923.1
AC026785 Genomic DNA No translation available.
DQ057356 mRNA No translation available.
DQ057357 mRNA No translation available.
DQ057358 mRNA No translation available.
DQ057359 mRNA No translation available.
DQ057360 mRNA No translation available.
X78926 mRNA Translation: CAA55526.1
CCDSiCCDS45012.1 [Q14587-1]
CCDS53853.1 [Q14587-4]
CCDS59240.1 [Q14587-6]
PIRiS47071
RefSeqiNP_001159353.1, NM_001165881.2 [Q14587-1]
NP_001159355.1, NM_001165883.1 [Q14587-6]
NP_001159356.2, NM_001165884.2
NP_001159357.1, NM_001165885.1
NP_001159358.1, NM_001165886.1
NP_001159359.1, NM_001165887.1
NP_003406.1, NM_003415.2 [Q14587-1]
NP_694422.2, NM_152943.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EL4NMR-A663-695[»]
2EL5NMR-A749-777[»]
2EL6NMR-A831-863[»]
2EM1NMR-A637-667[»]
2EMVNMR-A859-889[»]
2EMWNMR-A301-331[»]
2EMXNMR-A273-303[»]
2EMYNMR-A551-583[»]
2EN0NMR-A385-413[»]
2EN6NMR-A887-919[»]
2EN7NMR-A495-525[»]
2EOFNMR-A411-441[»]
2EOGNMR-A693-723[»]
2EOINMR-A329-359[»]
2EOJNMR-A355-385[»]
2EOKNMR-A441-469[»]
2EOLNMR-A581-609[»]
2EOPNMR-A719-751[»]
2EPVNMR-A803-833[»]
2EPWNMR-A915-947[»]
2EPYNMR-A525-553[»]
2YTFNMR-A607-639[»]
2YTQNMR-A775-807[»]
SMRiQ14587
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116010, 6 interactors
IntActiQ14587, 1 interactor
STRINGi9606.ENSP00000444412

PTM databases

iPTMnetiQ14587
PhosphoSitePlusiQ14587

Polymorphism and mutation databases

BioMutaiZNF268
DMDMi19863363

Proteomic databases

EPDiQ14587
jPOSTiQ14587
MassIVEiQ14587
MaxQBiQ14587
PaxDbiQ14587
PeptideAtlasiQ14587
PRIDEiQ14587
ProteomicsDBi60060 [Q14587-1]
60061 [Q14587-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
834 139 antibodies

Genome annotation databases

EnsembliENST00000228289; ENSP00000228289; ENSG00000090612 [Q14587-1]
ENST00000536435; ENSP00000444412; ENSG00000090612 [Q14587-1]
ENST00000539248; ENSP00000467781; ENSG00000090612 [Q14587-6]
ENST00000588312; ENSP00000466622; ENSG00000090612 [Q14587-7]
GeneIDi10795
KEGGihsa:10795
UCSCiuc010tbw.3 human [Q14587-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10795
DisGeNETi10795
EuPathDBiHostDB:ENSG00000090612.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF268
HGNCiHGNC:13061 ZNF268
HPAiENSG00000090612 Low tissue specificity
MIMi604753 gene
neXtProtiNX_Q14587
OpenTargetsiENSG00000090612
PharmGKBiPA37639

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000163459
HOGENOMiCLU_002678_17_1_1
InParanoidiQ14587
KOiK09228
OMAiAKGYECT
OrthoDBi1318335at2759
PhylomeDBiQ14587

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway
SIGNORiQ14587

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
10795 1 hit in 810 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF268 human
EvolutionaryTraceiQ14587

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZNF268

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10795
PharosiQ14587 Tbio

Protein Ontology

More...
PROi
PR:Q14587
RNActiQ14587 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000090612 Expressed in intestine and 215 other tissues
ExpressionAtlasiQ14587 baseline and differential
GenevisibleiQ14587 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 20 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 24 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 12 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 24 hits
PS50157 ZINC_FINGER_C2H2_2, 24 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN268_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14587
Secondary accession number(s): Q8TDG8, Q96RH4, Q9BZJ9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 29, 2001
Last modified: June 17, 2020
This is version 197 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again