Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Meiotic recombination protein DMC1/LIM15 homolog

Gene

DMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei230ssDNA or dsDNA1
Binding sitei233ssDNA1
Binding sitei236ssDNA or dsDNA1
Binding sitei242ssDNA or dsDNA1
Binding sitei311ssDNA1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi126 – 133ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: ProtInc
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: GO_Central
  • double-stranded DNA binding Source: GO_Central
  • four-way junction DNA binding Source: GO_Central
  • recombinase activity Source: GO_Central
  • single-stranded DNA binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processCell cycle, Meiosis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-912446 Meiotic recombination

Names & Taxonomyi

Protein namesi
Recommended name:
Meiotic recombination protein DMC1/LIM15 homolog
Gene namesi
Name:DMC1
Synonyms:DMC1H, LIM15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100206.9
HGNCiHGNC:2927 DMC1
MIMi602721 gene
neXtProtiNX_Q14565

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi258E → A or Q: Decreases octamer stability. 1 Publication1

Organism-specific databases

DisGeNETi11144
OpenTargetsiENSG00000100206
PharmGKBiPA27377

Polymorphism and mutation databases

DMDMi13878923

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001229181 – 340Meiotic recombination protein DMC1/LIM15 homologAdd BLAST340

Proteomic databases

PaxDbiQ14565
PeptideAtlasiQ14565
PRIDEiQ14565
ProteomicsDBi60046

PTM databases

PhosphoSitePlusiQ14565

Expressioni

Gene expression databases

BgeeiENSG00000100206
CleanExiHS_DMC1
ExpressionAtlasiQ14565 baseline and differential
GenevisibleiQ14565 HS

Organism-specific databases

HPAiCAB015397
HPA001232

Interactioni

Subunit structurei

Interacts with the MND1-PSMC3IP heterodimer (By similarity). Double stacked ring-shaped homooctamer. Interacts with BRCA2.By similarity2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi116316, 17 interactors
DIPiDIP-24192N
IntActiQ14565, 16 interactors
MINTiQ14565
STRINGi9606.ENSP00000216024

Structurei

Secondary structure

1340
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi85 – 87Combined sources3
Helixi88 – 95Combined sources8
Helixi106 – 111Combined sources6
Beta strandi114 – 118Combined sources5
Beta strandi120 – 127Combined sources8
Helixi132 – 142Combined sources11
Helixi148 – 150Combined sources3
Beta strandi155 – 163Combined sources9
Helixi167 – 177Combined sources11
Helixi181 – 186Combined sources6
Beta strandi188 – 192Combined sources5
Helixi196 – 212Combined sources17
Beta strandi216 – 223Combined sources8
Helixi227 – 232Combined sources6
Helixi235 – 237Combined sources3
Helixi239 – 259Combined sources21
Beta strandi263 – 268Combined sources6
Beta strandi287 – 289Combined sources3
Helixi290 – 296Combined sources7
Beta strandi298 – 305Combined sources8
Beta strandi310 – 317Combined sources8
Helixi322 – 324Combined sources3
Beta strandi325 – 331Combined sources7
Beta strandi334 – 337Combined sources4

3D structure databases

ProteinModelPortaliQ14565
SMRiQ14565
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14565

Family & Domainsi

Sequence similaritiesi

Belongs to the RecA family. DMC1 subfamily.Curated

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
COG0468 LUCA
GeneTreeiENSGT00760000119398
HOGENOMiHOG000227426
HOVERGENiHBG001504
InParanoidiQ14565
KOiK10872
OMAiCTVKGIQ
OrthoDBiEOG091G09QY
PhylomeDBiQ14565
TreeFamiTF300698

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011940 DMC1_rcmbase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR010995 DNA_repair_Rad51/TF_NusA_a-hlx
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
IPR020587 RecA_monomer-monomer_interface
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF47794 SSF47794, 1 hit
SSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR02238 recomb_DMC1, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit
PS50163 RECA_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14565-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKEDQVVAEE PGFQDEEESL FQDIDLLQKH GINVADIKKL KSVGICTIKG
60 70 80 90 100
IQMTTRRALC NVKGLSEAKV DKIKEAANKL IEPGFLTAFE YSEKRKMVFH
110 120 130 140 150
ITTGSQEFDK LLGGGIESMA ITEAFGEFRT GKTQLSHTLC VTAQLPGAGG
160 170 180 190 200
YPGGKIIFID TENTFRPDRL RDIADRFNVD HDAVLDNVLY ARAYTSEHQM
210 220 230 240 250
ELLDYVAAKF HEEAGIFKLL IIDSIMALFR VDFSGRGELA ERQQKLAQML
260 270 280 290 300
SRLQKISEEY NVAVFVTNQM TADPGATMTF QADPKKPIGG HILAHASTTR
310 320 330 340
ISLRKGRGEL RIAKIYDSPE MPENEATFAI TAGGIGDAKE
Length:340
Mass (Da):37,681
Last modified:April 27, 2001 - v2
Checksum:i040A6E4CF1FEBFA2
GO
Isoform 2 (identifier: Q14565-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-196: VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTS → G

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):31,559
Checksum:i0DDE121D137D5438
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti37I → N in BAA10970 (PubMed:8602360).Curated1
Sequence conflicti183A → P in BAA09932 (PubMed:8590282).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061757150G → D. Corresponds to variant dbSNP:rs58396845Ensembl.1
Natural variantiVAR_018960200M → V1 PublicationCorresponds to variant dbSNP:rs2227914Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055357141 – 196VTAQL…RAYTS → G in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63882 mRNA Translation: BAA09932.1
D64108 mRNA Translation: BAA10970.1
CR456486 mRNA Translation: CAG30372.1
AK292617 mRNA Translation: BAF85306.1
AK297664 mRNA Translation: BAG60028.1
AY520538 Genomic DNA Translation: AAR89915.1
AL022320 Genomic DNA No translation available.
BC125163 mRNA Translation: AAI25164.1
BC125164 mRNA Translation: AAI25165.1
CCDSiCCDS13973.1 [Q14565-1]
CCDS63477.1 [Q14565-2]
PIRiS62354
RefSeqiNP_001265137.1, NM_001278208.1 [Q14565-2]
NP_008999.2, NM_007068.3 [Q14565-1]
XP_006724175.1, XM_006724112.2 [Q14565-2]
UniGeneiHs.339396

Genome annotation databases

EnsembliENST00000216024; ENSP00000216024; ENSG00000100206 [Q14565-1]
ENST00000428462; ENSP00000412703; ENSG00000100206 [Q14565-2]
GeneIDi11144
KEGGihsa:11144
UCSCiuc003avz.3 human [Q14565-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDMC1_HUMAN
AccessioniPrimary (citable) accession number: Q14565
Secondary accession number(s): A8K9A2
, B4DMW6, Q08AI1, Q99498, Q9UH11
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 27, 2001
Last modified: July 18, 2018
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health