Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Meiotic recombination protein DMC1/LIM15 homolog

Gene

DMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei230ssDNA or dsDNA1 Publication1
Binding sitei233ssDNA1 Publication1
Binding sitei236ssDNA or dsDNA1 Publication1
Binding sitei242ssDNA or dsDNA1 Publication1
Binding sitei311ssDNA1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi126 – 133ATPCurated8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: ProtInc
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: GO_Central
  • double-stranded DNA binding Source: GO_Central
  • recombinase activity Source: GO_Central
  • single-stranded DNA binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processCell cycle, Meiosis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-912446 Meiotic recombination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Meiotic recombination protein DMC1/LIM15 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DMC1
Synonyms:DMC1H, LIM15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000100206.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2927 DMC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602721 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14565

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi230R → A: Abolishes binding to ssDNA or dsDNA. 1 Publication1
Mutagenesisi233F → A: Abolishes binding to ssDNA. 1 Publication1
Mutagenesisi236R → A: Abolishes binding to ssDNA or dsDNA. 1 Publication1
Mutagenesisi242R → A: Abolishes binding to ssDNA or dsDNA. 1 Publication1
Mutagenesisi258E → A or Q: Decreases octamer stability. 1 Publication1
Mutagenesisi311R → A: Abolishes binding to ssDNA. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
11144

Open Targets

More...
OpenTargetsi
ENSG00000100206

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
619 NON RARE IN EUROPE: Primary ovarian failure

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27377

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DMC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13878923

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001229181 – 340Meiotic recombination protein DMC1/LIM15 homologAdd BLAST340

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14565

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14565

PeptideAtlas

More...
PeptideAtlasi
Q14565

PRoteomics IDEntifications database

More...
PRIDEi
Q14565

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60046

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14565

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100206 Expressed in 139 organ(s), highest expression level in buccal mucosa cell

CleanEx database of gene expression profiles

More...
CleanExi
HS_DMC1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14565 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14565 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB015397
HPA001232

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the MND1-PSMC3IP heterodimer (By similarity). Double stacked ring-shaped homooctamer. Interacts with BRCA2.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116316, 17 interactors

Database of interacting proteins

More...
DIPi
DIP-24192N

Protein interaction database and analysis system

More...
IntActi
Q14565, 16 interactors

Molecular INTeraction database

More...
MINTi
Q14565

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000216024

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1340
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V5WX-ray3.20A/B1-340[»]
2ZJBX-ray3.50A/B1-340[»]
4HYYX-ray2.60A/B/C/D84-340[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q14565

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14565

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q14565

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RecA family. DMC1 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1433 Eukaryota
COG0468 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00760000119398

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000227426

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001504

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14565

KEGG Orthology (KO)

More...
KOi
K10872

Identification of Orthologs from Complete Genome Data

More...
OMAi
CTVKGIQ

Database of Orthologous Groups

More...
OrthoDBi
877394at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14565

TreeFam database of animal gene trees

More...
TreeFami
TF300698

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01123 Rad51_DMC1_radA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR011940 Dmc1
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR010995 DNA_repair_Rad51/TF_NusA_a-hlx
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
IPR020587 RecA_monomer-monomer_interface

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08423 Rad51, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005856 Rad51, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47794 SSF47794, 1 hit
SSF52540 SSF52540, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02238 recomb_DMC1, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50162 RECA_2, 1 hit
PS50163 RECA_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14565-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKEDQVVAEE PGFQDEEESL FQDIDLLQKH GINVADIKKL KSVGICTIKG
60 70 80 90 100
IQMTTRRALC NVKGLSEAKV DKIKEAANKL IEPGFLTAFE YSEKRKMVFH
110 120 130 140 150
ITTGSQEFDK LLGGGIESMA ITEAFGEFRT GKTQLSHTLC VTAQLPGAGG
160 170 180 190 200
YPGGKIIFID TENTFRPDRL RDIADRFNVD HDAVLDNVLY ARAYTSEHQM
210 220 230 240 250
ELLDYVAAKF HEEAGIFKLL IIDSIMALFR VDFSGRGELA ERQQKLAQML
260 270 280 290 300
SRLQKISEEY NVAVFVTNQM TADPGATMTF QADPKKPIGG HILAHASTTR
310 320 330 340
ISLRKGRGEL RIAKIYDSPE MPENEATFAI TAGGIGDAKE
Length:340
Mass (Da):37,681
Last modified:April 27, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i040A6E4CF1FEBFA2
GO
Isoform 2 (identifier: Q14565-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-196: VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTS → G

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):31,559
Checksum:i0DDE121D137D5438
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B0QYE1B0QYE1_HUMAN
Meiotic recombination protein DMC1/...
DMC1
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IYL1Q8IYL1_HUMAN
DMC1 protein
DMC1
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYE0B0QYE0_HUMAN
Meiotic recombination protein DMC1/...
DMC1
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti37I → N in BAA10970 (PubMed:8602360).Curated1
Sequence conflicti183A → P in BAA09932 (PubMed:8590282).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061757150G → D. Corresponds to variant dbSNP:rs58396845Ensembl.1
Natural variantiVAR_018960200M → V1 PublicationCorresponds to variant dbSNP:rs2227914Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055357141 – 196VTAQL…RAYTS → G in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D63882 mRNA Translation: BAA09932.1
D64108 mRNA Translation: BAA10970.1
CR456486 mRNA Translation: CAG30372.1
AK292617 mRNA Translation: BAF85306.1
AK297664 mRNA Translation: BAG60028.1
AY520538 Genomic DNA Translation: AAR89915.1
AL022320 Genomic DNA No translation available.
BC125163 mRNA Translation: AAI25164.1
BC125164 mRNA Translation: AAI25165.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13973.1 [Q14565-1]
CCDS63477.1 [Q14565-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
S62354

NCBI Reference Sequences

More...
RefSeqi
NP_001265137.1, NM_001278208.1 [Q14565-2]
NP_008999.2, NM_007068.3 [Q14565-1]
XP_006724175.1, XM_006724112.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.339396

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000216024; ENSP00000216024; ENSG00000100206 [Q14565-1]
ENST00000428462; ENSP00000412703; ENSG00000100206 [Q14565-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11144

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11144

UCSC genome browser

More...
UCSCi
uc003avz.3 human [Q14565-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63882 mRNA Translation: BAA09932.1
D64108 mRNA Translation: BAA10970.1
CR456486 mRNA Translation: CAG30372.1
AK292617 mRNA Translation: BAF85306.1
AK297664 mRNA Translation: BAG60028.1
AY520538 Genomic DNA Translation: AAR89915.1
AL022320 Genomic DNA No translation available.
BC125163 mRNA Translation: AAI25164.1
BC125164 mRNA Translation: AAI25165.1
CCDSiCCDS13973.1 [Q14565-1]
CCDS63477.1 [Q14565-2]
PIRiS62354
RefSeqiNP_001265137.1, NM_001278208.1 [Q14565-2]
NP_008999.2, NM_007068.3 [Q14565-1]
XP_006724175.1, XM_006724112.2
UniGeneiHs.339396

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V5WX-ray3.20A/B1-340[»]
2ZJBX-ray3.50A/B1-340[»]
4HYYX-ray2.60A/B/C/D84-340[»]
ProteinModelPortaliQ14565
SMRiQ14565
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116316, 17 interactors
DIPiDIP-24192N
IntActiQ14565, 16 interactors
MINTiQ14565
STRINGi9606.ENSP00000216024

PTM databases

PhosphoSitePlusiQ14565

Polymorphism and mutation databases

BioMutaiDMC1
DMDMi13878923

Proteomic databases

jPOSTiQ14565
PaxDbiQ14565
PeptideAtlasiQ14565
PRIDEiQ14565
ProteomicsDBi60046

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
11144
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216024; ENSP00000216024; ENSG00000100206 [Q14565-1]
ENST00000428462; ENSP00000412703; ENSG00000100206 [Q14565-2]
GeneIDi11144
KEGGihsa:11144
UCSCiuc003avz.3 human [Q14565-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11144
DisGeNETi11144
EuPathDBiHostDB:ENSG00000100206.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DMC1
HGNCiHGNC:2927 DMC1
HPAiCAB015397
HPA001232
MIMi602721 gene
neXtProtiNX_Q14565
OpenTargetsiENSG00000100206
Orphaneti619 NON RARE IN EUROPE: Primary ovarian failure
PharmGKBiPA27377

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
COG0468 LUCA
GeneTreeiENSGT00760000119398
HOGENOMiHOG000227426
HOVERGENiHBG001504
InParanoidiQ14565
KOiK10872
OMAiCTVKGIQ
OrthoDBi877394at2759
PhylomeDBiQ14565
TreeFamiTF300698

Enzyme and pathway databases

ReactomeiR-HSA-912446 Meiotic recombination

Miscellaneous databases

EvolutionaryTraceiQ14565

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DMC1_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11144

Protein Ontology

More...
PROi
PR:Q14565

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100206 Expressed in 139 organ(s), highest expression level in buccal mucosa cell
CleanExiHS_DMC1
ExpressionAtlasiQ14565 baseline and differential
GenevisibleiQ14565 HS

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011940 Dmc1
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR010995 DNA_repair_Rad51/TF_NusA_a-hlx
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
IPR020587 RecA_monomer-monomer_interface
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF47794 SSF47794, 1 hit
SSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR02238 recomb_DMC1, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit
PS50163 RECA_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14565
Secondary accession number(s): A8K9A2
, B4DMW6, Q08AI1, Q99498, Q9UH11
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 27, 2001
Last modified: January 16, 2019
This is version 170 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again