Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q14541 (HNF4G_HUMAN)

Entry version 209 (23 Feb 2022)
Sequence version 3 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Hepatocyte nuclear factor 4-gamma

Gene

HNF4G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor. Has a lower transcription activation potential than HNF4-alpha.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi9 – 84Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q14541

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-210745, Regulation of gene expression in beta cells
R-HSA-383280, Nuclear Receptor transcription pathway

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q14541

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q14541

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hepatocyte nuclear factor 4-gamma
Short name:
HNF-4-gamma
Alternative name(s):
Nuclear receptor subfamily 2 group A member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HNF4G
Synonyms:NR2A2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:5026, HNF4G

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605966, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q14541

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000164749

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3174

Open Targets

More...OpenTargetsi		ENSG00000164749

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29351

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q14541, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1961786

Drug and drug target database

More...DrugBanki		DB03796, Palmitic Acid

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HNF4G

Domain mapping of disease mutations (DMDM)

More...DMDMi		160110004

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535621 – 408Hepatocyte nuclear factor 4-gammaAdd BLAST408

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei94PhosphoserineBy similarity1
Modified residuei370PhosphothreonineBy similarity1
Modified residuei373PhosphothreonineBy similarity1
Modified residuei377PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q14541

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q14541

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q14541

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q14541

PeptideAtlas

More...PeptideAtlasi		Q14541

PRoteomics IDEntifications database

More...PRIDEi		Q14541

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60035 [Q14541-1]
60036 [Q14541-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q14541

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q14541

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000164749, Expressed in jejunal mucosa and 109 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q14541, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q14541, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000164749, Tissue enriched (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109416, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q14541, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000379701

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q14541, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1408
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q14541

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q14541

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini99 – 328NR LBDPROSITE-ProRule annotationAdd BLAST230

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni368 – 390DisorderedSequence analysisAdd BLAST23

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR2 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4215, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158224

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007368_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q14541

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q14541

TreeFam database of animal gene trees

More...TreeFami		TF352097

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00077

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14541-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTTDNGVNC LCAICGDRAT GKHYGASSCD GCKGFFRRSI RKSHVYSCRF 
        60         70         80         90        100
SRQCVVDKDK RNQCRYCRLR KCFRAGMKKE AVQNERDRIS TRRSTFDGSN 
       110        120        130        140        150
IPSINTLAQA EVRSRQISVS SPGSSTDINV KKIASIGDVC ESMKQQLLVL 
       160        170        180        190        200
VEWAKYIPAF CELPLDDQVA LLRAHAGEHL LLGATKRSMM YKDILLLGNN 
       210        220        230        240        250
YVIHRNSCEV EISRVANRVL DELVRPFQEI QIDDNEYACL KAIVFFDPDA 
       260        270        280        290        300
KGLSDPVKIK NMRFQVQIGL EDYINDRQYD SRGRFGELLL LLPTLQSITW 
       310        320        330        340        350
QMIEQIQFVK LFGMVKIDNL LQEMLLGGAS NDGSHLHHPM HPHLSQDPLT 
       360        370        380        390        400
GQTILLGPMS TLVHADQIST PETPLPSPPQ GSGQEQYKIA ANQASVISHQ 

HLSKQKQL
Length:408
Mass (Da):45,877
Last modified:November 13, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC75410E10251AE9F
GO
Isoform 2 (identifier: Q14541-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSM

Show »
Length:445
Mass (Da):50,041
Checksum:iCA8F19E4AF99E81B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A6E1WB48A0A6E1WB48_HUMAN
Hepatocyte nuclear factor 4-gamma
HNF4G
455Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAE11875 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28S → T in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti28S → T in AAF00110 (PubMed:10512380).Curated1
Sequence conflicti45V → I in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti45V → I in AAF00110 (PubMed:10512380).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_009704190M → I1 PublicationCorresponds to variant dbSNP:rs1805098Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0376911M → MDMANYSEVLDPTYTTLEFE TMQILYNSSDSSAPETSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z49826 mRNA Translation: CAA89990.2
BX571750 mRNA Translation: CAE11875.1 Different initiation.
AF133504 AF133503 Genomic DNA Translation: AAF00110.1
AF207953 Genomic DNA No translation available.
BC105009 mRNA Translation: AAI05010.1
BC105011 mRNA Translation: AAI05012.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS83303.1 [Q14541-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JC6095

NCBI Reference Sequences

More...RefSeqi		NP_001317490.1, NM_001330561.1 [Q14541-1]
NP_004124.4, NM_004133.4
XP_016868862.1, XM_017013373.1 [Q14541-1]
XP_016868863.1, XM_017013374.1 [Q14541-1]
XP_016868864.1, XM_017013375.1 [Q14541-1]
XP_016868865.1, XM_017013376.1 [Q14541-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000354370; ENSP00000346339; ENSG00000164749
ENST00000674002; ENSP00000501146; ENSG00000164749 [Q14541-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3174

UCSC genome browser

More...UCSCi		uc003yaq.4, human [Q14541-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Hepatocyte nuclear factors entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z49826 mRNA Translation: CAA89990.2
BX571750 mRNA Translation: CAE11875.1 Different initiation.
AF133504 AF133503 Genomic DNA Translation: AAF00110.1
AF207953 Genomic DNA No translation available.
BC105009 mRNA Translation: AAI05010.1
BC105011 mRNA Translation: AAI05012.1
CCDSiCCDS83303.1 [Q14541-1]
PIRiJC6095
RefSeqiNP_001317490.1, NM_001330561.1 [Q14541-1]
NP_004124.4, NM_004133.4
XP_016868862.1, XM_017013373.1 [Q14541-1]
XP_016868863.1, XM_017013374.1 [Q14541-1]
XP_016868864.1, XM_017013375.1 [Q14541-1]
XP_016868865.1, XM_017013376.1 [Q14541-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LV2X-ray2.70A103-328[»]
SMRiQ14541
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109416, 16 interactors
IntActiQ14541, 3 interactors
STRINGi9606.ENSP00000379701

Chemistry databases

ChEMBLiCHEMBL1961786
DrugBankiDB03796, Palmitic Acid

PTM databases

iPTMnetiQ14541
PhosphoSitePlusiQ14541

Genetic variation databases

BioMutaiHNF4G
DMDMi160110004

Proteomic databases

jPOSTiQ14541
MassIVEiQ14541
MaxQBiQ14541
PaxDbiQ14541
PeptideAtlasiQ14541
PRIDEiQ14541
ProteomicsDBi60035 [Q14541-1]
60036 [Q14541-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1695, 182 antibodies from 27 providers

The DNASU plasmid repository

More...DNASUi		3174

Genome annotation databases

EnsembliENST00000354370; ENSP00000346339; ENSG00000164749
ENST00000674002; ENSP00000501146; ENSG00000164749 [Q14541-2]
GeneIDi3174
KEGGihsa:3174
UCSCiuc003yaq.4, human [Q14541-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3174
DisGeNETi3174

GeneCards: human genes, protein and diseases

More...GeneCardsi		HNF4G
HGNCiHGNC:5026, HNF4G
HPAiENSG00000164749, Tissue enriched (intestine)
MIMi605966, gene
neXtProtiNX_Q14541
OpenTargetsiENSG00000164749
PharmGKBiPA29351
VEuPathDBiHostDB:ENSG00000164749

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4215, Eukaryota
GeneTreeiENSGT00940000158224
HOGENOMiCLU_007368_5_2_1
InParanoidiQ14541
PhylomeDBiQ14541
TreeFamiTF352097

Enzyme and pathway databases

PathwayCommonsiQ14541
ReactomeiR-HSA-210745, Regulation of gene expression in beta cells
R-HSA-383280, Nuclear Receptor transcription pathway
SignaLinkiQ14541
SIGNORiQ14541

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		3174, 10 hits in 1059 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HNF4G, human
EvolutionaryTraceiQ14541

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Hepatocyte_nuclear_factor_4_gamma

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3174
PharosiQ14541, Tbio

Protein Ontology

More...PROi		PR:Q14541
RNActiQ14541, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000164749, Expressed in jejunal mucosa and 109 other tissues
ExpressionAtlasiQ14541, baseline and differential
GenevisibleiQ14541, HS

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
IDEALiIID00077
InterProiView protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHNF4G_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14541
Secondary accession number(s): Q7Z2V9, Q9UH81, Q9UIS6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 13, 2007
Last modified: February 23, 2022
This is version 209 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again