Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (08 May 2019)
Sequence version 3 (02 Mar 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Adhesion G protein-coupled receptor E1

Gene

ADGRE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Orphan receptor involved in cell adhesion and probably in cell-cell interactions specifically involving cells of the immune system. May play a role in regulatory T-cells (Treg) development.By similarity

Miscellaneous

Most adhesion GPCRs proteins undergo autoproteolysis at the GPS domain. ADGRE1 is predicted non-cleavable because of the lack of a consensus catalytic triad sequence within GPS domain.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • G protein-coupled receptor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
Biological processAdaptive immunity, Immunity
LigandCalcium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-373080 Class B/2 (Secretin family receptors)

Protein family/group databases

MEROPS protease database

More...
MEROPSi
P02.004

Transport Classification Database

More...
TCDBi
9.A.14.6.1 the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adhesion G protein-coupled receptor E11 Publication
Alternative name(s):
EGF-like module receptor 1
EGF-like module-containing mucin-like hormone receptor-like 1
EMR1 hormone receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADGRE1Imported
Synonyms:EMR1, TM7LN3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3336 ADGRE1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600493 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14246

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 599ExtracellularCuratedAdd BLAST579
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei600 – 627Helical; Name=1Sequence analysisAdd BLAST28
Topological domaini628 – 634CytoplasmicCurated7
Transmembranei635 – 656Helical; Name=2Sequence analysisAdd BLAST22
Topological domaini657 – 666ExtracellularCurated10
Transmembranei667 – 690Helical; Name=3Sequence analysisAdd BLAST24
Topological domaini691 – 709CytoplasmicCuratedAdd BLAST19
Transmembranei710 – 731Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini732 – 747ExtracellularCuratedAdd BLAST16
Transmembranei748 – 776Helical; Name=5Sequence analysisAdd BLAST29
Topological domaini777 – 794CytoplasmicCuratedAdd BLAST18
Transmembranei795 – 814Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini815 – 829ExtracellularCuratedAdd BLAST15
Transmembranei830 – 852Helical; Name=7Sequence analysisAdd BLAST23
Topological domaini853 – 886CytoplasmicCuratedAdd BLAST34

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2015

Open Targets

More...
OpenTargetsi
ENSG00000174837

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27773

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADGRE1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
290457673

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Sequence analysisAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001287321 – 886Adhesion G protein-coupled receptor E1Add BLAST866

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
Disulfide bondi41 ↔ 56PROSITE-ProRule annotation
Disulfide bondi58 ↔ 78PROSITE-ProRule annotation
Disulfide bondi84 ↔ 97PROSITE-ProRule annotation
Disulfide bondi91 ↔ 106PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi94N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi108 ↔ 130PROSITE-ProRule annotation
Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi136 ↔ 148PROSITE-ProRule annotation
Disulfide bondi142 ↔ 157PROSITE-ProRule annotation
Disulfide bondi159 ↔ 170PROSITE-ProRule annotation
Glycosylationi167N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi176 ↔ 188PROSITE-ProRule annotation
Disulfide bondi182 ↔ 197PROSITE-ProRule annotation
Glycosylationi189N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi194N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi199 ↔ 219PROSITE-ProRule annotation
Disulfide bondi225 ↔ 235PROSITE-ProRule annotation
Disulfide bondi229 ↔ 244PROSITE-ProRule annotation
Glycosylationi232N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi246 ↔ 266PROSITE-ProRule annotation
Glycosylationi258N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi272 ↔ 285PROSITE-ProRule annotation
Disulfide bondi279 ↔ 294PROSITE-ProRule annotation
Disulfide bondi296 ↔ 315PROSITE-ProRule annotation
Glycosylationi312N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi366N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi375N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi448N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14246

PeptideAtlas

More...
PeptideAtlasi
Q14246

PRoteomics IDEntifications database

More...
PRIDEi
Q14246

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59945
59946 [Q14246-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14246

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14246

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expression is restricted to eosinophils.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174837 Expressed in 81 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14246 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14246 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052809

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q14246, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000311545

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 79EGF-like 1PROSITE-ProRule annotationAdd BLAST49
Domaini80 – 131EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST52
Domaini132 – 171EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini172 – 220EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST49
Domaini221 – 267EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST47
Domaini268 – 316EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd BLAST49
Domaini547 – 596GPSPROSITE-ProRule annotationAdd BLAST50

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi317 – 599Ser/Thr-richAdd BLAST283

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4193 Eukaryota
ENOG410XSD2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161354

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294115

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14246

KEGG Orthology (KO)

More...
KOi
K04591

Identification of Orthologs from Complete Genome Data

More...
OMAi
HSTCHNS

Database of Orthologous Groups

More...
OrthoDBi
124090at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14246

TreeFam database of animal gene trees

More...
TreeFami
TF316380

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR017981 GPCR_2-like
IPR001740 GPCR_2_EMR1-like_rcpt
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR009030 Growth_fac_rcpt_cys_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002 7tm_2, 1 hit
PF12662 cEGF, 1 hit
PF07645 EGF_CA, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01128 EMR1HORMONER
PR00249 GPCRSECRETIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 6 hits
SM00179 EGF_CA, 6 hits
SM00303 GPS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57184 SSF57184, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 6 hits
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 6 hits
PS01187 EGF_CA, 5 hits
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Comment=Additional isoforms seem to exist.

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14246-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRGFNLLLFW GCCVMHSWEG HIRPTRKPNT KGNNCRDSTL CPAYATCTNT
60 70 80 90 100
VDSYYCACKQ GFLSSNGQNH FKDPGVRCKD IDECSQSPQP CGPNSSCKNL
110 120 130 140 150
SGRYKCSCLD GFSSPTGNDW VPGKPGNFSC TDINECLTSS VCPEHSDCVN
160 170 180 190 200
SMGSYSCSCQ VGFISRNSTC EDVDECADPR ACPEHATCNN TVGNYSCFCN
210 220 230 240 250
PGFESSSGHL SFQGLKASCE DIDECTEMCP INSTCTNTPG SYFCTCHPGF
260 270 280 290 300
APSNGQLNFT DQGVECRDID ECRQDPSTCG PNSICTNALG SYSCGCIAGF
310 320 330 340 350
HPNPEGSQKD GNFSCQRVLF KCKEDVIPDN KQIQQCQEGT AVKPAYVSFC
360 370 380 390 400
AQINNIFSVL DKVCENKTTV VSLKNTTESF VPVLKQISTW TKFTKEETSS
410 420 430 440 450
LATVFLESVE SMTLASFWKP SANITPAVRT EYLDIESKVI NKECSEENVT
460 470 480 490 500
LDLVAKGDKM KIGCSTIEES ESTETTGVAF VSFVGMESVL NERFFKDHQA
510 520 530 540 550
PLTTSEIKLK MNSRVVGGIM TGEKKDGFSD PIIYTLENIQ PKQKFERPIC
560 570 580 590 600
VSWSTDVKGG RWTSFGCVIL EASETYTICS CNQMANLAVI MASGELTMDF
610 620 630 640 650
SLYIISHVGI IISLVCLVLA IATFLLCRSI RNHNTYLHLH LCVCLLLAKT
660 670 680 690 700
LFLAGIHKTD NKMGCAIIAG FLHYLFLACF FWMLVEAVIL FLMVRNLKVV
710 720 730 740 750
NYFSSRNIKM LHICAFGYGL PMLVVVISAS VQPQGYGMHN RCWLNTETGF
760 770 780 790 800
IWSFLGPVCT VIVINSLLLT WTLWILRQRL SSVNAEVSTL KDTRLLTFKA
810 820 830 840 850
FAQLFILGCS WVLGIFQIGP VAGVMAYLFT IINSLQGAFI FLIHCLLNGQ
860 870 880
VREEYKRWIT GKTKPSSQSQ TSRILLSSMP SASKTG
Length:886
Mass (Da):97,683
Last modified:March 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i07322996EEF5A6F1
GO
Isoform 2 (identifier: Q14246-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     599-663: Missing.

Note: No experimental confirmation available.
Show »
Length:821
Mass (Da):90,379
Checksum:i3F57FE01A3F8AC7F
GO
Isoform 3 (identifier: Q14246-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     764-764: I → VSKYYNSLAKCVLKEEQGDLRDLEFPGTCAAERI

Note: No experimental confirmation available.
Show »
Length:867
Mass (Da):95,944
Checksum:iDEC584294CD20916
GO
Isoform 4 (identifier: Q14246-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-316: Missing.

Note: No experimental confirmation available.
Show »
Length:709
Mass (Da):78,907
Checksum:i8A817BC4B479F950
GO
Isoform 5 (identifier: Q14246-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     132-220: Missing.

Note: No experimental confirmation available.
Show »
Length:745
Mass (Da):82,771
Checksum:i23007B9E3859C5C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R2G7M0R2G7_HUMAN
Adhesion G protein-coupled receptor...
ADGRE1
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC06133 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61G → R in BAH12472 (PubMed:14702039).Curated1
Sequence conflicti212F → C in CAA57232 (PubMed:7601460).Curated1
Sequence conflicti424I → A in BAH12475 (PubMed:14702039).Curated1
Sequence conflicti430T → A in CAA57232 (PubMed:7601460).Curated1
Sequence conflicti545F → L in BAH12475 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0469762R → L. Corresponds to variant dbSNP:rs34176643Ensembl.1
Natural variantiVAR_02761657A → T2 PublicationsCorresponds to variant dbSNP:rs330877Ensembl.1
Natural variantiVAR_027617140S → R1 PublicationCorresponds to variant dbSNP:rs330880Ensembl.1
Natural variantiVAR_027618174D → N1 PublicationCorresponds to variant dbSNP:rs897738Ensembl.1
Natural variantiVAR_027619254N → S1 PublicationCorresponds to variant dbSNP:rs443658Ensembl.1
Natural variantiVAR_027620298A → V1 PublicationCorresponds to variant dbSNP:rs370094Ensembl.1
Natural variantiVAR_027621389T → M1 PublicationCorresponds to variant dbSNP:rs466876Ensembl.1
Natural variantiVAR_027622424I → V3 PublicationsCorresponds to variant dbSNP:rs457857Ensembl.1
Natural variantiVAR_027623496K → Q3 PublicationsCorresponds to variant dbSNP:rs373533Ensembl.1
Natural variantiVAR_027624539I → V3 PublicationsCorresponds to variant dbSNP:rs461645Ensembl.1
Natural variantiVAR_027625589V → I2 PublicationsCorresponds to variant dbSNP:rs7256147Ensembl.1
Natural variantiVAR_046977663M → T1 PublicationCorresponds to variant dbSNP:rs2228539Ensembl.1
Natural variantiVAR_027626691F → C. Corresponds to variant dbSNP:rs2229769Ensembl.1
Natural variantiVAR_027627724V → L. Corresponds to variant dbSNP:rs10406580Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04552180 – 131Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_045522132 – 220Missing in isoform 5. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_045523140 – 316Missing in isoform 4. 1 PublicationAdd BLAST177
Alternative sequenceiVSP_009594599 – 663Missing in isoform 2. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_045524764I → VSKYYNSLAKCVLKEEQGDL RDLEFPGTCAAERI in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X81479 mRNA Translation: CAA57232.1
AB065918 Genomic DNA Translation: BAC06133.1 Sequence problems.
DQ217942 Genomic DNA Translation: ABB70739.1
AK131562 mRNA Translation: BAD18695.1
AK297003 mRNA Translation: BAH12472.1
AK297011 mRNA Translation: BAH12475.1
AC020895 Genomic DNA No translation available.
AC025278 Genomic DNA No translation available.
BC059395 mRNA Translation: AAH59395.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12175.1 [Q14246-1]
CCDS58643.1 [Q14246-4]
CCDS58644.1 [Q14246-2]
CCDS58645.1 [Q14246-3]
CCDS58646.1 [Q14246-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
A57172

NCBI Reference Sequences

More...
RefSeqi
NP_001243181.1, NM_001256252.1 [Q14246-3]
NP_001243182.1, NM_001256253.1 [Q14246-2]
NP_001243183.1, NM_001256254.1 [Q14246-5]
NP_001243184.1, NM_001256255.1 [Q14246-4]
NP_001965.3, NM_001974.4 [Q14246-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000250572; ENSP00000250572; ENSG00000174837 [Q14246-2]
ENST00000312053; ENSP00000311545; ENSG00000174837 [Q14246-1]
ENST00000381404; ENSP00000370811; ENSG00000174837 [Q14246-3]
ENST00000381407; ENSP00000370814; ENSG00000174837 [Q14246-5]
ENST00000450315; ENSP00000405974; ENSG00000174837 [Q14246-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2015

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2015

UCSC genome browser

More...
UCSCi
uc002mfw.5 human [Q14246-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X81479 mRNA Translation: CAA57232.1
AB065918 Genomic DNA Translation: BAC06133.1 Sequence problems.
DQ217942 Genomic DNA Translation: ABB70739.1
AK131562 mRNA Translation: BAD18695.1
AK297003 mRNA Translation: BAH12472.1
AK297011 mRNA Translation: BAH12475.1
AC020895 Genomic DNA No translation available.
AC025278 Genomic DNA No translation available.
BC059395 mRNA Translation: AAH59395.1
CCDSiCCDS12175.1 [Q14246-1]
CCDS58643.1 [Q14246-4]
CCDS58644.1 [Q14246-2]
CCDS58645.1 [Q14246-3]
CCDS58646.1 [Q14246-5]
PIRiA57172
RefSeqiNP_001243181.1, NM_001256252.1 [Q14246-3]
NP_001243182.1, NM_001256253.1 [Q14246-2]
NP_001243183.1, NM_001256254.1 [Q14246-5]
NP_001243184.1, NM_001256255.1 [Q14246-4]
NP_001965.3, NM_001974.4 [Q14246-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ14246, 1 interactor
STRINGi9606.ENSP00000311545

Protein family/group databases

MEROPSiP02.004
TCDBi9.A.14.6.1 the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiQ14246
PhosphoSitePlusiQ14246

Polymorphism and mutation databases

BioMutaiADGRE1
DMDMi290457673

Proteomic databases

PaxDbiQ14246
PeptideAtlasiQ14246
PRIDEiQ14246
ProteomicsDBi59945
59946 [Q14246-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2015
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250572; ENSP00000250572; ENSG00000174837 [Q14246-2]
ENST00000312053; ENSP00000311545; ENSG00000174837 [Q14246-1]
ENST00000381404; ENSP00000370811; ENSG00000174837 [Q14246-3]
ENST00000381407; ENSP00000370814; ENSG00000174837 [Q14246-5]
ENST00000450315; ENSP00000405974; ENSG00000174837 [Q14246-4]
GeneIDi2015
KEGGihsa:2015
UCSCiuc002mfw.5 human [Q14246-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2015
DisGeNETi2015

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADGRE1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0021954
HIX0174373
HGNCiHGNC:3336 ADGRE1
HPAiHPA052809
MIMi600493 gene
neXtProtiNX_Q14246
OpenTargetsiENSG00000174837
PharmGKBiPA27773

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4193 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00940000161354
HOGENOMiHOG000294115
InParanoidiQ14246
KOiK04591
OMAiHSTCHNS
OrthoDBi124090at2759
PhylomeDBiQ14246
TreeFamiTF316380

Enzyme and pathway databases

ReactomeiR-HSA-373080 Class B/2 (Secretin family receptors)

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ADGRE1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
EMR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2015

Protein Ontology

More...
PROi
PR:Q14246

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174837 Expressed in 81 organ(s), highest expression level in blood
ExpressionAtlasiQ14246 baseline and differential
GenevisibleiQ14246 HS

Family and domain databases

InterProiView protein in InterPro
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR017981 GPCR_2-like
IPR001740 GPCR_2_EMR1-like_rcpt
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR009030 Growth_fac_rcpt_cys_sf
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF12662 cEGF, 1 hit
PF07645 EGF_CA, 4 hits
PRINTSiPR01128 EMR1HORMONER
PR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00181 EGF, 6 hits
SM00179 EGF_CA, 6 hits
SM00303 GPS, 1 hit
SUPFAMiSSF57184 SSF57184, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 6 hits
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 6 hits
PS01187 EGF_CA, 5 hits
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGRE1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14246
Secondary accession number(s): A6NHV2
, B7Z486, B7Z489, E7EPX9, E9PD45, H9KV79, Q2I7G5, Q6ZMN0, Q8NGA7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: May 8, 2019
This is version 189 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again