Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (22 Apr 2020)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ensconsin

Gene

MAP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-stabilizing protein that may play an important role during reorganization of microtubules during polarization and differentiation of epithelial cells. Associates with microtubules in a dynamic manner. May play a role in the formation of intercellular contacts. Colocalization with TRPV4 results in the redistribution of TRPV4 toward the membrane and may link cytoskeletal microfilaments.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor binding Source: BHF-UCL
  • structural molecule activity Source: ProtInc

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ensconsin
Alternative name(s):
Epithelial microtubule-associated protein of 115 kDa
Short name:
E-MAP-115
Microtubule-associated protein 7
Short name:
MAP-7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAP7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6869 MAP7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604108 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14244

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9053

Open Targets

More...
OpenTargetsi
ENSG00000135525

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30615

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q14244 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MAP7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74739817

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002559492 – 749EnsconsinAdd BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Modified residuei183PhosphoserineCombined sources1
Modified residuei200PhosphoserineCombined sources1
Modified residuei202PhosphoserineCombined sources1
Modified residuei209PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei231PhosphothreonineCombined sources1
Modified residuei235PhosphoserineCombined sources1
Modified residuei254PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki273Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei277PhosphothreonineCombined sources1
Modified residuei282PhosphoserineCombined sources1
Cross-linki295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei335PhosphoserineCombined sources1
Modified residuei365PhosphoserineCombined sources1
Cross-linki373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki377Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki406Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei673PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The association with microtubules is regulated by phosphorylation during the cell cycle. During interphase only phosphorylated on serine. Phosphorylated on threonine in mitosis.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14244

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q14244

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q14244

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q14244

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q14244

PeptideAtlas

More...
PeptideAtlasi
Q14244

PRoteomics IDEntifications database

More...
PRIDEi
Q14244

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19484
25627
59940 [Q14244-1]
59941 [Q14244-2]
59942 [Q14244-3]
59943 [Q14244-4]
59944 [Q14244-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14244

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14244

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the skin and cells of epithelial origin. Predominantly expressed in the suprabasal layers of the normal epidermis and relatively abundant in squamous cell carcinomas but barely detectable in basal cell carcinomas.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated upon terminal differentiation of primary keratinocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135525 Expressed in corpus callosum and 175 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14244 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14244 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000135525 Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TRPV4.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114515, 118 interactors

Protein interaction database and analysis system

More...
IntActi
Q14244, 39 interactors

Molecular INTeraction database

More...
MINTi
Q14244

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000482335

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q14244 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14244

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili89 – 152Sequence analysisAdd BLAST64
Coiled coili477 – 612Sequence analysisAdd BLAST136

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi316 – 451Pro-richAdd BLAST136

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAP7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIRT Eukaryota
ENOG410XS5W LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182941

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017315_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14244

KEGG Orthology (KO)

More...
KOi
K10433

Database of Orthologous Groups

More...
OrthoDBi
738080at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14244

TreeFam database of animal gene trees

More...
TreeFami
TF332273

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030707 MAP7
IPR008604 MAP7_fam

The PANTHER Classification System

More...
PANTHERi
PTHR15073:SF4 PTHR15073:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05672 MAP7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14244-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELGAGGDG HRGGDGAVRS ETAPDSYKVQ DKKNASSRPA SAISGQNNNH
60 70 80 90 100
SGNKPDPPPV LRVDDRQRLA RERREEREKQ LAAREIVWLE REERARQHYE
110 120 130 140 150
KHLEERKKRL EEQRQKEERR RAAVEEKRRQ RLEEDKERHE AVVRRTMERS
160 170 180 190 200
QKPKQKHNRW SWGGSLHGSP SIHSADPDRR SVSTMNLSKY VDPVISKRLS
210 220 230 240 250
SSSATLLNSP DRARRLQLSP WESSVVNRLL TPTHSFLARS KSTAALSGEA
260 270 280 290 300
ASCSPIIMPY KAAHSRNSMD RPKLFVTPPE GSSRRRIIHG TASYKKERER
310 320 330 340 350
ENVLFLTSGT RRAVSPSNPK ARQPARSRLW LPSKSLPHLP GTPRPTSSLP
360 370 380 390 400
PGSVKAAPAQ VRPPSPGNIR PVKREVKVEP EKKDPEKEPQ KVANEPSLKG
410 420 430 440 450
RAPLVKVEEA TVEERTPAEP EVGPAAPAMA PAPASAPAPA SAPAPAPVPT
460 470 480 490 500
PAMVSAPSST VNASASVKTS AGTTDPEEAT RLLAEKRRLA REQREKEERE
510 520 530 540 550
RREQEELERQ KREELAQRVA EERTTRREEE SRRLEAEQAR EKEEQLQRQA
560 570 580 590 600
EERALREREE AERAQRQKEE EARVREEAER VRQEREKHFQ REEQERLERK
610 620 630 640 650
KRLEEIMKRT RRTEATDKKT SDQRNGDIAK GALTGGTEVS ALPCTTNAPG
660 670 680 690 700
NGKPVGSPHV VTSHQSKVTV ESTPDLEKQP NENGVSVQNE NFEEIINLPI
710 720 730 740
GSKPSRLDVT NSESPEIPLN PILAFDDEGT LGPLPQVDGV QTQQTAEVI
Length:749
Mass (Da):84,052
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCB69BDE25C9540E3
GO
Isoform 2 (identifier: Q14244-2) [UniParc]FASTAAdd to basket
Also known as: E-MAP-115-105

The sequence of this isoform differs from the canonical sequence as follows:
     176-212: Missing.

Show »
Length:712
Mass (Da):79,976
Checksum:iECAA14610C717550
GO
Isoform 3 (identifier: Q14244-3) [UniParc]FASTAAdd to basket
Also known as: E-MAP-115-95

The sequence of this isoform differs from the canonical sequence as follows:
     82-175: Missing.

Show »
Length:655
Mass (Da):72,414
Checksum:i5DB5677DDD254C2E
GO
Isoform 4 (identifier: Q14244-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MAELGAGGDGHRGGDGAVRSET → MPGSATALRHERLKKTNARPIPLGLFTINEEDEQQKNGNSRRPK
     176-212: Missing.

Show »
Length:734
Mass (Da):82,877
Checksum:iECC44D5E7D550F48
GO
Isoform 5 (identifier: Q14244-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:603
Mass (Da):66,938
Checksum:i276DC81A68500D90
GO
Isoform 6 (identifier: Q14244-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: MAELGAGGDGHRGGDGAVRSETA → MEDTKLYS

Show »
Length:734
Mass (Da):82,867
Checksum:i442B7844C6097C72
GO
Isoform 7 (identifier: Q14244-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MAELGAGGDGHRGGDGAVRSET → MPGSATALRHERLKKTNARPIPLGLFTINEEDEQQKNGNSRRPK

Show »
Length:771
Mass (Da):86,952
Checksum:iF91E6CBDDD0DB6D9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WZ40A0A087WZ40_HUMAN
Ensconsin
MAP7
779Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti318N → D in BAH13013 (PubMed:14702039).Curated1
Sequence conflicti583Q → R in BAH12386 (PubMed:14702039).Curated1
Sequence conflicti725F → S in BAH13013 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034091361V → I. Corresponds to variant dbSNP:rs35350783Ensembl.1
Natural variantiVAR_034092526R → P. Corresponds to variant dbSNP:rs35107962Ensembl.1
Natural variantiVAR_028880558R → W2 PublicationsCorresponds to variant dbSNP:rs2076190Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0433351 – 146Missing in isoform 5. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_0467581 – 23MAELG…RSETA → MEDTKLYS in isoform 6. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0433361 – 22MAELG…VRSET → MPGSATALRHERLKKTNARP IPLGLFTINEEDEQQKNGNS RRPK in isoform 4 and isoform 7. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_02131682 – 175Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_021317176 – 212Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X73882 mRNA Translation: CAA52086.1
AJ242501 mRNA Translation: CAB88030.1
AJ242502 mRNA Translation: CAB88031.1
AK294461 mRNA Translation: BAH11776.1
AK296556 mRNA Translation: BAH12386.1
AK299355 mRNA Translation: BAH13013.1
AK316062 mRNA Translation: BAH14433.1
AL024508 Genomic DNA No translation available.
AL023284 Genomic DNA No translation available.
AL133511 Genomic DNA No translation available.
BC025777 mRNA Translation: AAH25777.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5178.1 [Q14244-1]
CCDS56452.1 [Q14244-5]
CCDS56453.1 [Q14244-6]
CCDS56454.1 [Q14244-4]
CCDS56455.1 [Q14244-7]
CCDS75528.1 [Q14244-3]
CCDS75529.1 [Q14244-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I37356

NCBI Reference Sequences

More...
RefSeqi
NP_001185537.1, NM_001198608.1 [Q14244-7]
NP_001185538.1, NM_001198609.1
NP_001185540.1, NM_001198611.1 [Q14244-4]
NP_001185543.1, NM_001198614.1 [Q14244-7]
NP_001185544.1, NM_001198615.1 [Q14244-6]
NP_001185545.1, NM_001198616.1 [Q14244-2]
NP_001185546.1, NM_001198617.1 [Q14244-3]
NP_001185547.1, NM_001198618.1 [Q14244-5]
NP_001185548.1, NM_001198619.1 [Q14244-5]
NP_003971.1, NM_003980.4 [Q14244-1]
XP_006715663.1, XM_006715600.2 [Q14244-7]
XP_016866960.1, XM_017011471.1 [Q14244-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000354570; ENSP00000346581; ENSG00000135525 [Q14244-1]
ENST00000432797; ENSP00000414879; ENSG00000135525 [Q14244-5]
ENST00000438100; ENSP00000400790; ENSG00000135525 [Q14244-4]
ENST00000454590; ENSP00000414712; ENSG00000135525 [Q14244-7]
ENST00000544465; ENSP00000445737; ENSG00000135525 [Q14244-6]
ENST00000611373; ENSP00000482998; ENSG00000135525 [Q14244-5]
ENST00000616617; ENSP00000483511; ENSG00000135525 [Q14244-3]
ENST00000618822; ENSP00000482356; ENSG00000135525 [Q14244-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9053

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9053

UCSC genome browser

More...
UCSCi
uc003qgz.4 human [Q14244-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X73882 mRNA Translation: CAA52086.1
AJ242501 mRNA Translation: CAB88030.1
AJ242502 mRNA Translation: CAB88031.1
AK294461 mRNA Translation: BAH11776.1
AK296556 mRNA Translation: BAH12386.1
AK299355 mRNA Translation: BAH13013.1
AK316062 mRNA Translation: BAH14433.1
AL024508 Genomic DNA No translation available.
AL023284 Genomic DNA No translation available.
AL133511 Genomic DNA No translation available.
BC025777 mRNA Translation: AAH25777.1
CCDSiCCDS5178.1 [Q14244-1]
CCDS56452.1 [Q14244-5]
CCDS56453.1 [Q14244-6]
CCDS56454.1 [Q14244-4]
CCDS56455.1 [Q14244-7]
CCDS75528.1 [Q14244-3]
CCDS75529.1 [Q14244-2]
PIRiI37356
RefSeqiNP_001185537.1, NM_001198608.1 [Q14244-7]
NP_001185538.1, NM_001198609.1
NP_001185540.1, NM_001198611.1 [Q14244-4]
NP_001185543.1, NM_001198614.1 [Q14244-7]
NP_001185544.1, NM_001198615.1 [Q14244-6]
NP_001185545.1, NM_001198616.1 [Q14244-2]
NP_001185546.1, NM_001198617.1 [Q14244-3]
NP_001185547.1, NM_001198618.1 [Q14244-5]
NP_001185548.1, NM_001198619.1 [Q14244-5]
NP_003971.1, NM_003980.4 [Q14244-1]
XP_006715663.1, XM_006715600.2 [Q14244-7]
XP_016866960.1, XM_017011471.1 [Q14244-4]

3D structure databases

SMRiQ14244
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114515, 118 interactors
IntActiQ14244, 39 interactors
MINTiQ14244
STRINGi9606.ENSP00000482335

PTM databases

iPTMnetiQ14244
PhosphoSitePlusiQ14244

Polymorphism and mutation databases

BioMutaiMAP7
DMDMi74739817

Proteomic databases

EPDiQ14244
jPOSTiQ14244
MassIVEiQ14244
MaxQBiQ14244
PaxDbiQ14244
PeptideAtlasiQ14244
PRIDEiQ14244
ProteomicsDBi19484
25627
59940 [Q14244-1]
59941 [Q14244-2]
59942 [Q14244-3]
59943 [Q14244-4]
59944 [Q14244-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33011 138 antibodies

The DNASU plasmid repository

More...
DNASUi
9053

Genome annotation databases

EnsembliENST00000354570; ENSP00000346581; ENSG00000135525 [Q14244-1]
ENST00000432797; ENSP00000414879; ENSG00000135525 [Q14244-5]
ENST00000438100; ENSP00000400790; ENSG00000135525 [Q14244-4]
ENST00000454590; ENSP00000414712; ENSG00000135525 [Q14244-7]
ENST00000544465; ENSP00000445737; ENSG00000135525 [Q14244-6]
ENST00000611373; ENSP00000482998; ENSG00000135525 [Q14244-5]
ENST00000616617; ENSP00000483511; ENSG00000135525 [Q14244-3]
ENST00000618822; ENSP00000482356; ENSG00000135525 [Q14244-2]
GeneIDi9053
KEGGihsa:9053
UCSCiuc003qgz.4 human [Q14244-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9053
DisGeNETi9053

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAP7
HGNCiHGNC:6869 MAP7
HPAiENSG00000135525 Tissue enhanced (brain)
MIMi604108 gene
neXtProtiNX_Q14244
OpenTargetsiENSG00000135525
PharmGKBiPA30615

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIRT Eukaryota
ENOG410XS5W LUCA
GeneTreeiENSGT00950000182941
HOGENOMiCLU_017315_2_1_1
InParanoidiQ14244
KOiK10433
OrthoDBi738080at2759
PhylomeDBiQ14244
TreeFamiTF332273

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MAP7 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MAP7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9053
PharosiQ14244 Tbio

Protein Ontology

More...
PROi
PR:Q14244
RNActiQ14244 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135525 Expressed in corpus callosum and 175 other tissues
ExpressionAtlasiQ14244 baseline and differential
GenevisibleiQ14244 HS

Family and domain databases

InterProiView protein in InterPro
IPR030707 MAP7
IPR008604 MAP7_fam
PANTHERiPTHR15073:SF4 PTHR15073:SF4, 1 hit
PfamiView protein in Pfam
PF05672 MAP7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAP7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14244
Secondary accession number(s): B7Z290
, B7Z400, B7Z5S7, B7Z9U7, C9JPS0, E9PCP3, F5H1E2, Q7Z6S0, Q8TAU5, Q9NY82, Q9NY83
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: November 1, 1996
Last modified: April 22, 2020
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again