Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (31 Jul 2019)
Sequence version 3 (10 Oct 2002)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein BTG3

Gene

BTG3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein BTG3
Alternative name(s):
Abundant in neuroepithelium area protein
BTG family member 3
Protein Tob5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BTG3
Synonyms:ANA, TOB5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1132 BTG3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605674 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q14201

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10950

Open Targets

More...
OpenTargetsi
ENSG00000154640

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25452

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BTG3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
23830904

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001438071 – 252Protein BTG3Add BLAST252

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q14201

PeptideAtlas

More...
PeptideAtlasi
Q14201

PRoteomics IDEntifications database

More...
PRIDEi
Q14201

ProteomicsDB human proteome resource

More...
ProteomicsDBi
59920 [Q14201-1]
59921 [Q14201-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q14201

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q14201

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000154640 Expressed in 214 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q14201 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q14201 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA018400

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
E2F1Q010943EBI-948192,EBI-448924

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116150, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q14201, 4 interactors

Molecular INTeraction database

More...
MINTi
Q14201

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q14201

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi144 – 149Poly-Ser6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BTG family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182952

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234823

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q14201

KEGG Orthology (KO)

More...
KOi
K14443

Identification of Orthologs from Complete Genome Data

More...
OMAi
CCRYGEQ

Database of Orthologous Groups

More...
OrthoDBi
1455216at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q14201

TreeFam database of animal gene trees

More...
TreeFami
TF105272

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.1120, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002087 Anti_prolifrtn
IPR036054 BTG-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07742 BTG, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00310 ANTIPRLFBTG1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00099 btg1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF160696 SSF160696, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00960 BTG_1, 1 hit
PS01203 BTG_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q14201-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKNEIAAVVF FFTRLVRKHD KLKKEAVERF AEKLTLILQE KYKNHWYPEK
60 70 80 90 100
PSKGQAYRCI RVNKFQRVDP DVLKACENSC ILYSDLGLPK ELTLWVDPCE
110 120 130 140 150
VCCRYGEKNN AFIVASFENK DENKDEISRK VTRALDKVTS DYHSGSSSSD
160 170 180 190 200
EETSKEMEVK PSSVTAAASP VYQISELIFP PLPMWHPLPR KKPGMYRGNG
210 220 230 240 250
HQNHYPPPVP FGYPNQGRKN KPYRPIPVTW VPPPGMHCDR NHWINPHMLA

PH
Length:252
Mass (Da):29,116
Last modified:October 10, 2002 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBEBE7E15709D2CC7
GO
Isoform 2 (identifier: Q14201-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-104: R → RRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIM

Show »
Length:296
Mass (Da):34,163
Checksum:i0AC870F223ECE2DE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JLA2C9JLA2_HUMAN
Protein BTG3
BTG3
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRS5A0A0G2JRS5_HUMAN
Protein BTG3
BTG3
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRT0A0A0G2JRT0_HUMAN
Protein BTG3
BTG3
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti40E → G in BAA33788 (PubMed:9632145).Curated1
Sequence conflicti45H → P in BAA33788 (PubMed:9632145).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000578104R → RRDGVSPCWPDCSQTPDLVI RPPWPPKALDYRREPLRPAS SFLIM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D64110 mRNA Translation: BAA33788.1
BT007276 mRNA Translation: AAP35940.1
CH471079 Genomic DNA Translation: EAX10026.1
CH471079 Genomic DNA Translation: EAX10029.1
BC011957 mRNA Translation: AAH11957.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13569.1 [Q14201-1]
CCDS46636.1 [Q14201-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T09539

NCBI Reference Sequences

More...
RefSeqi
NP_001124386.1, NM_001130914.1 [Q14201-2]
NP_006797.3, NM_006806.4 [Q14201-1]
XP_016883754.1, XM_017028265.1 [Q14201-1]
XP_016883755.1, XM_017028266.1 [Q14201-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339775; ENSP00000344609; ENSG00000154640 [Q14201-2]
ENST00000348354; ENSP00000284879; ENSG00000154640 [Q14201-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10950

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10950

UCSC genome browser

More...
UCSCi
uc002ykl.4 human [Q14201-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D64110 mRNA Translation: BAA33788.1
BT007276 mRNA Translation: AAP35940.1
CH471079 Genomic DNA Translation: EAX10026.1
CH471079 Genomic DNA Translation: EAX10029.1
BC011957 mRNA Translation: AAH11957.1
CCDSiCCDS13569.1 [Q14201-1]
CCDS46636.1 [Q14201-2]
PIRiT09539
RefSeqiNP_001124386.1, NM_001130914.1 [Q14201-2]
NP_006797.3, NM_006806.4 [Q14201-1]
XP_016883754.1, XM_017028265.1 [Q14201-1]
XP_016883755.1, XM_017028266.1 [Q14201-1]

3D structure databases

SMRiQ14201
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116150, 15 interactors
IntActiQ14201, 4 interactors
MINTiQ14201

PTM databases

iPTMnetiQ14201
PhosphoSitePlusiQ14201

Polymorphism and mutation databases

BioMutaiBTG3
DMDMi23830904

Proteomic databases

EPDiQ14201
PeptideAtlasiQ14201
PRIDEiQ14201
ProteomicsDBi59920 [Q14201-1]
59921 [Q14201-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10950
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339775; ENSP00000344609; ENSG00000154640 [Q14201-2]
ENST00000348354; ENSP00000284879; ENSG00000154640 [Q14201-1]
GeneIDi10950
KEGGihsa:10950
UCSCiuc002ykl.4 human [Q14201-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10950
DisGeNETi10950

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BTG3
HGNCiHGNC:1132 BTG3
HPAiHPA018400
MIMi605674 gene
neXtProtiNX_Q14201
OpenTargetsiENSG00000154640
PharmGKBiPA25452

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00950000182952
HOGENOMiHOG000234823
InParanoidiQ14201
KOiK14443
OMAiCCRYGEQ
OrthoDBi1455216at2759
PhylomeDBiQ14201
TreeFamiTF105272

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BTG3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BTG3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10950

Protein Ontology

More...
PROi
PR:Q14201

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000154640 Expressed in 214 organ(s), highest expression level in placenta
ExpressionAtlasiQ14201 baseline and differential
GenevisibleiQ14201 HS

Family and domain databases

Gene3Di1.20.120.1120, 1 hit
InterProiView protein in InterPro
IPR002087 Anti_prolifrtn
IPR036054 BTG-like_sf
PfamiView protein in Pfam
PF07742 BTG, 1 hit
PRINTSiPR00310 ANTIPRLFBTG1
SMARTiView protein in SMART
SM00099 btg1, 1 hit
SUPFAMiSSF160696 SSF160696, 1 hit
PROSITEiView protein in PROSITE
PS00960 BTG_1, 1 hit
PS01203 BTG_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBTG3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q14201
Secondary accession number(s): D3DSC4, Q53XV1, Q96ET7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 10, 2002
Last modified: July 31, 2019
This is version 151 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again